spacer

EBI Dbfetch

ID   EU785971; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EU785971;
XX
DT   30-SEP-2008 (Rel. 97, Created)
DT   30-SEP-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40/B*07 allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Aggarwal R., Stamm L., Potok E., Hickerty J., Mullan C., Malysh B.-l.,
RA   Ott C., Senitzer D., Fernandez-vina M., Zhao W., Berka N.;
RT   "A New HLA-B Allele Sharing Sequences with B*4006 and B*0702";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Aggarwal R., Stamm L., Potok E., Hickerty J., Mullan C., Malysh B.-l.,
RA   Ott C., Senitzer D., Fernandez-vina M., Zhao W., Berka N.;
RT   ;
RL   Submitted (03-JUN-2008) to the INSDC.
RL   Tissue Typing Laboratory, Calgary Laboratory Services, 9, 3535 Research Rd
RL   NW, Calgary, Alberta T2L 2K8, Canada
XX
DR   MD5; 6c857e525c61fe357afa61560d2739f4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40/B*07"
FT                   /note="shared allele with similarity to B*4006 and B*0702"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40/B*07"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40/B*07"
FT                   /product="MHC class I antigen"
FT                   /note="glycoprotein; human leukocyte antigen B; makes the
FT                   alpha 1 domain of HLA-B antigen that presents class I
FT                   peptides to CD8 T-cells"
FT                   /db_xref="GOA:B6D4Y0"
FT                   /db_xref="IMGT/HLA:B*40:93"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6D4Y0"
FT                   /protein_id="ACH92820.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40/B*07"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40/B*07"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 170 C; 194 G; 72 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer