Dbfetch

ID   EU785343; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   EU785343;
XX
DT   15-JUN-2008 (Rel. 96, Created)
DT   15-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*260101 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RA   Du G., Zhang B., Cheng S., Xing P., Du J., Ma R., Kong D., Wang Y.;
RT   "A novel HLA allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1642
RA   Du G., Zhang B., Cheng S., Xing P., Du J., Ma R., Kong D., Wang Y.;
RT   ;
RL   Submitted (04-JUN-2008) to the INSDC.
RL   R&D, Transfusion Institute, Henan Red Cross Blood Center, 9 Tongle Road,
RL   Zhengzhou, Henan Province 450012, China
XX
DR   MD5; 17450d07dc49eddbff477ef6aca76483.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*26:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B3GUH8"
FT                   /protein_id="ACE60612.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTHRANLGTLRGYYNQSEDGSHTVQRMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWETAHEAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT                   /number=3
FT   gap             788..1366
FT                   /estimated_length=579
FT   exon            1367..1642
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*260101"
FT                   /number=4
XX
SQ   Sequence 1642 BP; 174 A; 248 C; 282 G; 118 T; 820 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactca ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc agcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggagacggcc catgaggcgg agcagtggag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg      1380
     catatgactc accacgctgt ctctgaccat gaagccaccc tgaggtgctg ggccctgagc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1500
     acggagctcg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcggctgtg      1560
     gtggtgcctt ctggacagga gcagagatac acctgccatg tgcagcatga gggtttgccc      1620
     aagcccctca ccctgagatg gg                                               1642
//