Dbfetch

ID   EU785342; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   EU785342;
XX
DT   15-JUN-2008 (Rel. 96, Created)
DT   15-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*510201 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RA   Xing P., Zhang B., Cheng S., Du G., Zhao L., Du J., Ma R., Kong D.;
RT   ;
RL   Submitted (19-MAY-2008) to the INSDC.
RL   R&D, Transfusion Institute, Henan Red Cross Blood Center, 9 Tongle Road,
RL   Zhengzhou, Henan Province 450012, China
XX
DR   MD5; 6614d380374d516c769e6485e281ddfe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT   mRNA            join(<1..270,512..787,1367..>1642)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..787,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B3GUH7"
FT                   /db_xref="IMGT/HLA:B*51:02:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B3GUH7"
FT                   /protein_id="ACE60611.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT                   /number=3
FT   gap             788..1366
FT                   /estimated_length=579
FT   exon            1367..1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*510201"
FT                   /number=4
XX
SQ   Sequence 1642 BP; 181 A; 255 C; 270 G; 116 T; 820 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nggtctcaca cttggcagac gatgtatggc       540
     tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg agctcctgga ccgcggcgga caccgcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgtgaggcgg agcagctgag agcctacctg       720
     gagggcctgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcgcggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca      1380
     cacgtgaccc accaccccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac      1500
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg      1560
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg      1620
     aagcccctca ccctgagatg gg                                               1642
//