spacer

EBI Dbfetch

ID   EU770203; SV 1; linear; genomic DNA; STD; HUM; 932 BP.
XX
AC   EU770203;
XX
DT   05-JUL-2008 (Rel. 96, Created)
DT   05-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*03novel allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-932
RA   Thompson E.M., Mehdizadeh Kashi Z., Martin R.K.;
RT   "Homo sapiens novel MHC class II HLA-DQB1 gene HLA-DQB1*03novel allele,
RT   exons 2 and 3";
RL   Unpublished.
XX
RN   [2]
RP   1-932
RA   Thompson E.M., Mehdizadeh Kashi Z., Martin R.K.;
RT   ;
RL   Submitted (28-MAY-2008) to the INSDC.
RL   Kashi Clinical Laboratories, 8075 SW Nimbus Ave., Beaverton, OR 97008, USA
XX
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..932
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>932
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03novel"
FT   mRNA            join(<1..270,651..>932)
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03novel"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,651..>932)
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03novel"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="ACF16333.1"
FT                   /translation="DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGRLDAEYWNSQKDILEEDRASVDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEAL
FT                   NHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRG
FT                   DVYTCHVEHPSLQNPIIVEW"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03novel"
FT                   /number=2
FT   gap             271..650
FT                   /estimated_length=380
FT   exon            651..932
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*03novel"
FT                   /number=3
XX
SQ   Sequence 932 BP; 125 A; 161 C; 164 G; 102 T; 380 other;
     aggatttcgt gtaccagttt aagggcatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc ggcttgacgc cgagtactgg aatagccaga       180
     aggacatcct ggaggaggac cgggcgtcgg tggacaccgt atgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn tggagcccac       660
     agtgaccatc tccccatcca ggacagaggc cctcaaccac cacaacctgc tggtctgctc       720
     agtgacagat ttctatccag cccagatcaa agtccggtgg tttcggaatg accaggagga       780
     gacaactggc gttgtgtcca ccccccttat taggaacggt gactggacct tccagatcct       840
     ggtgatgctg gaaatgactc cccagcgtgg agacgtctac acctgccacg tggagcaccc       900
     cagcctccag aaccccatca tcgtggagtg gc                                     932
//


spacer
spacer