Dbfetch

ID   EU729350; SV 1; linear; genomic DNA; STD; HUM; 294 BP.
XX
AC   EU729350;
XX
DT   26-JAN-2009 (Rel. 99, Created)
DT   26-JAN-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPA1) gene, HLA-DPA1-new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-294
RX   DOI; 10.1016/j.humimm.2008.09.001.
RX   PUBMED; 18838095.
RA   Peterson T.A., Luo M., Mao X., Brunham R.C., Plummer F.A.;
RT   "Identification of a novel DPA1 allele, DPA1*010602, in an East African
RT   population";
RL   Hum. Immunol. 69(12):885-886(2008).
XX
RN   [2]
RP   1-294
RA   Peterson T.A., Luo M., Mao X., Brunham R.C., Plummer F.A.;
RT   ;
RL   Submitted (19-MAY-2008) to the INSDC.
RL   Department of Medical Microbiology, University of Manitoba, 730 William
RL   Avenue, Winnipeg, Manitoba, Canada
XX
DR   MD5; 0cf2ef38472b23ed841f748bd937b4c6.
DR   Ensembl-Gn; ENSG00000168384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228163; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235844; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236177; homo_sapiens.
DR   Ensembl-Tr; ENST00000374808; homo_sapiens.
DR   Ensembl-Tr; ENST00000383224; homo_sapiens.
DR   Ensembl-Tr; ENST00000415247; homo_sapiens.
DR   Ensembl-Tr; ENST00000419277; homo_sapiens.
DR   Ensembl-Tr; ENST00000422504; homo_sapiens.
DR   Ensembl-Tr; ENST00000443117; homo_sapiens.
DR   Ensembl-Tr; ENST00000454805; homo_sapiens.
DR   Ensembl-Tr; ENST00000515317; homo_sapiens.
DR   EuropePMC; PMC2628164; 18838095.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..294
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>294
FT                   /gene="HLA-DPA1"
FT                   /allele="new"
FT   mRNA            <16..>261
FT                   /gene="HLA-DPA1"
FT                   /allele="new"
FT                   /product="MHC class II antigen"
FT   CDS             <16..>261
FT                   /codon_start=3
FT                   /gene="HLA-DPA1"
FT                   /allele="new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P20036"
FT                   /db_xref="HGNC:HGNC:4938"
FT                   /db_xref="IMGT/HLA:DPA1*01:06:02"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5K"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20036"
FT                   /protein_id="ACH88749.1"
FT                   /translation="DHVSTYAAFVQTHRPTGEFMFEFDEDEQFYVDLDKKETVWHLEEF
FT                   GQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATN"
FT   exon            16..261
FT                   /gene="HLA-DPA1"
FT                   /allele="new"
FT                   /number=2
XX
SQ   Sequence 294 BP; 70 A; 72 C; 72 G; 80 T; 0 other;
     actgtcttta tgcagcggac catgtgtcaa cttatgccgc gtttgtacag acgcatagac        60
     caacagggga gtttatgttt gaatttgatg aagatgagca gttctatgtg gatctggaca       120
     agaaggagac cgtctggcat ctggaggagt ttggccaagc cttttccttt gaggctcagg       180
     gcgggctggc taacattgct atattgaaca acaacttgaa taccttgatc cagcgttcca       240
     accacactca ggccaccaac ggtacgccct atctttgcct cttcctctgt agcc             294
//