spacer

EBI Dbfetch

ID   EU693920; SV 1; linear; genomic DNA; STD; HUM; 1020 BP.
XX
AC   EU693920;
XX
DT   01-JUN-2008 (Rel. 96, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B*15 variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1020
RX   DOI; 10.1111/j.1399-0039.2009.01344.x.
RX   PUBMED; 19845903.
RA   Zou H.Y., Li Z., Jin S.Z., Cheng X., Cheng L.H.;
RT   "A frame shift due to a two-nucleotide deletion results in an HLA-B null
RT   allele, B*9549N";
RL   Tissue Antigens 74(5):447-449(2009).
XX
RN   [2]
RP   1-1020
RA   Zou H.-Y., Li Z., Cheng X.;
RT   "A new HLA-B*15 allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-1020
RA   Zou H.-Y., Li Z., Cheng X.;
RT   ;
RL   Submitted (04-MAY-2008) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; e38acbb3fe6660502e3f7ed6cdbf66c1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1020
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1020
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT   mRNA            join(<1..268,369..>438)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..268,369..438)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /product="truncated MHC class I antigen"
FT                   /note="frameshift mutations results in premature stop
FT                   codon"
FT                   /db_xref="GOA:B3GFZ6"
FT                   /db_xref="IMGT/HLA:B*15:149N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B3GFZ6"
FT                   /protein_id="ACD75762.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTDLQDQHTDLPREPAEPARLLQPERGRVSHPPEDVRLRRGAG
FT                   RAPPPRA"
FT   exon            1..268
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=2
FT   variation       185^186
FT                   /gene="HLA-B"
FT                   /replace="ca"
FT                   /note="compared to HLAB*151101"
FT   gap             269..368
FT                   /estimated_length=unknown
FT   exon            369..>438
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15 variant"
FT                   /number=3
FT   gap             645..744
FT                   /estimated_length=unknown
XX
SQ   Sequence 1020 BP; 179 A; 256 C; 273 G; 112 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac agatctacaa gaccaacaca cagacttacc gagagagcct gcggaacctg       240
     cgcggctact acaaccagag cgaggccgnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnngg tctcacaccc tccagaggat gtacggctgc gacgtggggc cggacgggcg       420
     cctcctccgc gggcatgacc agtccgccta cgacggcaag gattacatcg ccctgaacga       480
     ggacctgagc tcctggaccg cggcggacac ggcggctcag atcacccagc gcaagtggga       540
     ggcggcccgt gaggcggagc agtggagagc ctacctggag ggcctgtgcg tggagtggct       600
     ccgcagatac ctggagaacg ggaaggagac gctgcagcgc gcggnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnaccccc caaagacaca tgtgacccac caccccatct       780
     ctgaccatga ggccaccctg aggtgctggg ccctgggctt ctaccctgcg gagatcacac       840
     tgacctggca gcgggatggc gaggaccaaa ctcaggacac cgagcttgtg gagaccagac       900
     cagcaggaga tagaaccttc cagaagtggg cagctgtggt ggtgccttct ggagaagagc       960
     agagatacac atgccatgta cagcatgagg ggctgccgaa gcccctcacc ctgagatggg      1020
//


spacer
spacer