Dbfetch

ID   EU683685; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU683685;
XX
DT   24-MAY-2008 (Rel. 95, Created)
DT   24-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (DRB1) gene, DRB1*01 allele, exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a new HLA-DRB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (29-APR-2008) to the INSDC.
RL   Histocompatibility, CTM, Avenida De La Democracia, Madrid 28032, Spain
XX
DR   MD5; bc32146b465e88ba0846148d2b416188.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*01"
FT   mRNA            <1..>270
FT                   /gene="DRB1"
FT                   /allele="DRB1*01"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="DRB1"
FT                   /allele="DRB1*01"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B2ZSE3"
FT                   /db_xref="IMGT/HLA:DRB1*01:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B2ZSE3"
FT                   /protein_id="ACD63076.1"
FT                   /translation="RFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="DRB1"
FT                   /allele="DRB1*01"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 62 C; 100 G; 51 T; 0 other;
     cacgtttctt gtggcagctt aagtttgaat gtcatttctt caatgggacg gagcgggtgc        60
     ggttgctgga aagatgcatc tataaccaag aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//