spacer

EBI Dbfetch

ID   EU678649; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU678649;
XX
DT   12-JUN-2008 (Rel. 96, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens clone HAN-1026 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*04 allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wohlwend G., Regen L., Smith A., Hansen J.A.;
RT   "New HLA-DRB1*04 alleles identified in a hematopoietic stem cell transplant
RT   population";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Wohlwend G., Regen L., Smith A., Hansen J.A.;
RT   ;
RL   Submitted (24-APR-2008) to the INSDC.
RL   Clinical Immunogenetics, Seattle Cancer Care Alliance, 825 Eastlake Ave E.,
RL   Seattle, WA 98108, USA
XX
DR   MD5; 8f72df57f87bb9b1d99f2e154376417d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /clone="HAN-1026"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B3GDG8"
FT                   /db_xref="IMGT/HLA:DRB1*04:76"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B3GDG8"
FT                   /protein_id="ACE00046.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TEMGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 64 C; 97 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagatggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer