spacer

EBI Dbfetch

ID   EU678647; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   EU678647;
XX
DT   12-JUN-2008 (Rel. 96, Created)
DT   12-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens clone HAN-1024 MHC class II antigen (HLA-DRB1) gene,
DE   HLA-DRB1*04 allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RA   Wohlwend G., Regen L., Smith A., Hansen J.A.;
RT   "Rare HLA-DRB1*04 alleles identified in a hematopoietic stem cell
RT   transplant population";
RL   Unpublished.
XX
RN   [2]
RP   1-246
RA   Wohlwend G., Regen L., Smith A., Hansen J.A.;
RT   ;
RL   Submitted (24-APR-2008) to the INSDC.
RL   Clinical Immunogenetics, Seattle Cancer Care Alliance, 825 Eastlake Ave E.,
RL   Seattle, WA 98108, USA
XX
DR   MD5; eaf743897df09cc57babf0556aa98c96.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /clone="HAN-1024"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>246
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT   mRNA            <1..>246
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B3GDG6"
FT                   /db_xref="IMGT/HLA:DRB1*04:26"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B3GDG6"
FT                   /protein_id="ACE00044.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDTEYWNSQKDLLEQKRAAVDTYCRHNYGVG"
FT   exon            1..>246
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04"
FT                   /number=2
XX
SQ   Sequence 246 BP; 55 A; 59 C; 87 G; 45 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatac cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtg                                                                  246
//


spacer
spacer