spacer

EBI Dbfetch

ID   EU672816; SV 1; linear; genomic DNA; STD; HUM; 1167 BP.
XX
AC   EU672816;
XX
DT   04-JUN-2008 (Rel. 96, Created)
DT   04-JUN-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*52 variant allele,
DE   exons 2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1167
RA   Yang E.K.L.;
RT   "A novel B*52 variant found in Taiwan volunteer bone marrow donor";
RL   Unpublished.
XX
RN   [2]
RP   1-1167
RA   Yang E.K.L.;
RT   ;
RL   Submitted (23-APR-2008) to the INSDC.
RL   Lab of Immunogenetics, Tzu Chi Stem Cells Center, 707 Sec.3 Chung-Yang Rd.,
RL   Hualien 970, Taiwan
XX
DR   MD5; 08fe64ec5fb5198e9689d29364f31306.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1167
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1167
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT   mRNA            join(<1..270,516..791,892..>1167)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,892..>1167)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B3GCI4"
FT                   /db_xref="IMGT/HLA:B*52:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B3GCI4"
FT                   /protein_id="ACD77188.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /number=3
FT   gap             792..891
FT                   /estimated_length=unknown
FT   exon            892..1167
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /number=4
XX
SQ   Sequence 1167 BP; 209 A; 348 C; 363 G; 147 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gtgctgaccg cggggccggg gccagggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naccccccaa       900
     agacacacgt gacccaccac cccgtctctg accatgaggc caccctgagg tgctgggccc       960
     tgggcttcta ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc      1020
     aggacactga gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag      1080
     ctgtggtggt gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc      1140
     tgccgaagcc cctcaccctg agatggg                                          1167
//


spacer
spacer