Dbfetch

ID   EU660882; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU660882;
XX
DT   17-MAY-2008 (Rel. 95, Created)
DT   25-SEP-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Publication Status: Available-Online prior to print
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01315.x.
RX   PUBMED; 19624613.
RA   Kelsch R., Binder T.M., Elsner H.A., Eiermann T.H., Sibrowski W.;
RT   "An HLA-DR11/DQ3 haplotype with a DRB1*0301 sequence motif in the third
RT   hypervariable region of the HLA-DR beta-1 chain: molecular and serological
RT   analysis of its generation in a European Caucasian family";
RL   Tissue Antigens 74(4):330-335(2009).
XX
RN   [2]
RP   1-270
RA   Kelsch R., Binder T., Dieker A.;
RT   "New HLA-DRB1 Exon 2 variant with sequence motifs from HLA-DRB1*03 and
RT   HLA-DRB1*11 or DRB1*13";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Kelsch R., Binder T., Dieker A.;
RT   ;
RL   Submitted (18-APR-2008) to the INSDC.
RL   University Clinics of Muenster, Institute for Transfusion Medicin and
RL   Transplantation Immunology, Domagkstrasse 11, Muenster, NRW 48161, Germany
XX
DR   MD5; 37b35890ea212974249d1668c95a3759.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B2ZGJ0"
FT                   /db_xref="IMGT/HLA:DRB1*03:40"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B2ZGJ0"
FT                   /protein_id="ACD40041.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//