spacer

EBI Dbfetch

ID   EU649706; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU649706;
XX
DT   24-MAY-2008 (Rel. 95, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/tan.12101.
RX   PUBMED; 23646950.
RA   Zhang K.Y., Zhang Z.X., Liu N., Ni L., Shan X.Y.;
RT   "The novel allele HLA-A*02:145 differs from HLA-A*02:01:01 by a single
RT   amino acid exchange at position 153 from alanine to valine";
RL   Tissue Antigens 81(6):449-450(2013).
XX
RN   [2]
RP   1-276
RA   Shan X., Wang L., He X., Ni L., Cui S., Wang L., Li W., Liu N., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Shan X., Wang L., He X., Ni L., Cui S., Wang L., Li W., Liu N., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   ;
RL   Submitted (15-APR-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No. 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 0836fd3617bf3e3820642b333a5eaec9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2ZES7"
FT                   /db_xref="IMGT/HLA:A*02:145"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2ZES7"
FT                   /protein_id="ACD62376.1"
FT                   /translation="SHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVVEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
FT   variation       187
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="results in substitution of alanine for valine"
XX
SQ   Sequence 276 BP; 58 A; 78 C; 98 G; 42 T; 0 other;
     gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggactgg cgcttcctcc        60
     gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg gaggcggccc       180
     atgtggtgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer