Dbfetch

ID   EU643640; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU643640;
XX
DT   02-JUN-2008 (Rel. 96, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*new allele, exon 2 and
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2009.01290.x.
RX   PUBMED; 19497034.
RA   Xiao Y., Zhou X.Y., Liu N., Zhang Z.X., Cai J.P.;
RT   "Identification of a novel allele HLA-A*2489 by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 74(3):249-250(2009).
XX
RN   [2]
RP   1-270
RA   Cai J.P., Xiao Y., Zhou X.Y., Hei A.L., Dai D.P.;
RT   "A novel allele identified by SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Cai J.P., Xiao Y., Zhou X.Y., Hei A.L., Dai D.P.;
RT   ;
RL   Submitted (09-APR-2008) to the INSDC.
RL   Molecular Biology Lab, National Center for Clinical Laboratory, No 1
RL   Dongdan Dahua Road, Dongcheng District, Beijing 100730, China
XX
DR   MD5; 3e24bead0fe6a5f9f4c6bb4575a8e400.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT   mRNA            <1..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:A*24:89"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B3G4T8"
FT                   /protein_id="ACD76111.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=2
XX
SQ   Sequence 270 BP; 52 A; 85 C; 97 G; 36 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//