spacer

EBI Dbfetch

ID   EU643597; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   EU643597;
XX
DT   06-MAY-2008 (Rel. 95, Created)
DT   06-MAY-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens isolate BY00319 MHC class I antigen (HLA-B) gene,
DE   HLA-B*0350101 variant allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (14-APR-2008) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 7c8402e942d7c5b1ae28cc951571c8eb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00319"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0350101 variant"
FT   mRNA            <1..>546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0350101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0350101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2ZCW2"
FT                   /db_xref="IMGT/HLA:B*35:91"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2ZCW2"
FT                   /protein_id="ACD01075.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQSKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..546
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*0350101 variant"
FT                   /number=2
XX
SQ   Sequence 546 BP; 113 A; 173 C; 187 G; 73 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gagcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer