spacer

EBI Dbfetch

ID   EU627183; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EU627183;
XX
DT   05-MAY-2008 (Rel. 95, Created)
DT   19-JAN-2011 (Rel. 107, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*26 new allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2010.01592.x.
RX   PUBMED; 21214528.
RA   Li J.P., Li X.F., Chen Y., Zhang X., Liu X.Z.;
RT   "Identification of a novel HLA-A*26 allele, A*26:36, by sequence-based
RT   typing";
RL   Tissue Antigens 77(2):154-155(2011).
XX
RN   [2]
RP   1-646
RA   Li J., Liu X., Chen Y.;
RT   ;
RL   Submitted (09-APR-2008) to the INSDC.
RL   HLA Genotyping Lab, Liaoning Blood Center, Beihai, Shenyang, Liaoning
RL   110044, China
XX
DR   MD5; 1f03883845c88bdfc25941a01fad0511.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 new"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen-A"
FT                   /db_xref="GOA:B2ZAW2"
FT                   /db_xref="IMGT/HLA:A*26:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2ZAW2"
FT                   /protein_id="ACD01048.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTHRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   gap             271..370
FT                   /estimated_length=unknown
XX
SQ   Sequence 646 BP; 110 A; 166 C; 196 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactca ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagagg atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtacca gcaggacgct tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gagacggccc atgaggcgga gcagtggaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer