Dbfetch

ID   EU617015; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EU617015;
XX
DT   08-MAY-2008 (Rel. 95, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*01 new allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2009.01346.x.
RX   PUBMED; 19737370.
RA   Li Z., Zhang H., Jin S.Z.;
RT   "Identification of a new HLA-Cw*01 variant, Cw*0121, by sequence-based
RT   typing in a Chinese patient";
RL   Tissue Antigens 74(5):449-451(2009).
XX
RN   [2]
RP   1-646
RA   Li Z., Zou H.-Y., Cheng L.-H.;
RT   "A new HLA-Cw allele observed in Chinese Han";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Li Z., Zou H.-Y., Cheng L.-H.;
RT   ;
RL   Submitted (03-APR-2008) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 8ab7bbcb921a8028c99395e112c12d5f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01 new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*01:21"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2Z8W3"
FT                   /protein_id="ACC86064.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01 new"
FT                   /number=2
FT   variation       128
FT                   /gene="HLA-Cw"
FT                   /replace="g"
FT                   /note="as compared to HLA-Cw*0104"
FT   variation       216
FT                   /gene="HLA-Cw"
FT                   /replace="a"
FT                   /note="as compared to HLA-Cw*0104"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*01 new"
FT                   /number=3
FT   variation       388
FT                   /gene="HLA-Cw"
FT                   /replace="t"
FT                   /note="as compared to HLA-Cw*0104"
FT   variation       395..396
FT                   /gene="HLA-Cw"
FT                   /replace="gt"
FT                   /note="as compared to HLA-Cw*0104"
XX
SQ   Sequence 646 BP; 106 A; 169 C; 198 G; 73 T; 100 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgctgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//