spacer

EBI Dbfetch

ID   EU594580; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EU594580;
XX
DT   16-MAY-2008 (Rel. 95, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*0702new allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   PUBMED; 23398514.
RA   Wang D., Liu N., Wang L., Ni L., Zhang Z.;
RT   "Characterization of a novel HLA-C*07 allele, HLA-C*07:56:01";
RL   Tissue Antigens 81(3):181-182(2013).
XX
RN   [2]
RP   1-646
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., He X., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., He X., Gong Z.,
RA   Zhao B., Zhang Z.;
RT   ;
RL   Submitted (26-MAR-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; e1cb666a98ae38e50d61ddb7d436b45e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0702new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0702new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0702new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2Z3W4"
FT                   /db_xref="IMGT/HLA:C*07:56:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2Z3W4"
FT                   /protein_id="ACC64603.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEARSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0702new"
FT                   /number=2
FT   variation       270
FT                   /gene="HLA-C"
FT                   /replace="g"
FT                   /note="as compared to HLA-C*0702; results in arginine to
FT                   glycine substitution"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*0702new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 105 A; 174 C; 196 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtctggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac accgcggctc agatcaccca gcgcaagttg       540
     gaggcggccc gtgcggcgga gcagctgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcag                      646
//


spacer
spacer