spacer

EBI Dbfetch

ID   EU594579; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU594579;
XX
DT   16-MAY-2008 (Rel. 95, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0601new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12100.
RX   PUBMED; 23646956.
RA   Zhang K.Y., Zhang Z.X., Ni L., Wang L., Shan X.Y.;
RT   "The novel allele HLA-DQB1*06:01:04 differs from HLA-DQB1*06:01:01 by a
RT   single synonymous nucleotide exchange";
RL   Tissue Antigens 81(6):468-469(2013).
XX
RN   [2]
RP   1-270
RA   Zhang Z., Shan X., Liu N., Li W., Wang L., He X., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B.;
RT   "Identified a novel allele by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Zhang Z., Shan X., Liu N., Li W., Wang L., He X., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B.;
RT   ;
RL   Submitted (17-MAR-2008) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 5d543462c48938422cdd0500ec2619e8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0601new"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0601new"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0601new"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B2Z3W3"
FT                   /db_xref="IMGT/HLA:DQB1*06:01:04"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B2Z3W3"
FT                   /protein_id="ACC64602.1"
FT                   /translation="DFVLQFKAMCYFTNGTERVRYVTRYIYNREEDVRFDSDVGVYRAV
FT                   TPQGRPDAEYWNSQKDILERTRAELDTVCRHNYEVAFRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /allele="HLA-DQB1*0601new"
FT                   /number=2
FT   variation       156
FT                   /gene="HLA-DQB1"
FT                   /replace="c"
FT                   /note="as compared to HLA-DQB1*0601"
XX
SQ   Sequence 270 BP; 61 A; 65 C; 97 G; 47 T; 0 other;
     aggatttcgt gctccagttt aaggccatgt gctacttcac caatggcacg gagcgcgtgc        60
     gttatgtgac cagatacatc tataaccgag aggaggacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctgacgc cgagtactgg aacagccaga       180
     aggacatcct ggagaggacc cgagcggagt tggacacggt gtgcagacac aactacgagg       240
     tggcgttccg cgggatcttg cagaggagag                                        270
//


spacer
spacer