spacer

EBI Dbfetch

ID   EU564807; SV 1; linear; genomic DNA; STD; HUM; 789 BP.
XX
AC   EU564807;
XX
DT   05-APR-2008 (Rel. 95, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*350107 allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-789
RA   Wang Q., Cao K., Duong H., Naim M., Ong G., Reinsmoen N.L.;
RT   "A Novel B*350101 Variant Identified by Sequence Based Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-789
RA   Wang Q., Cao K., Duong H., Naim M., Ong G., Reinsmoen N.L.;
RT   ;
RL   Submitted (14-MAR-2008) to the INSDC.
RL   HLA Laboratory, Comprehensive Transplant Center, Department of Medicine,
RL   Cedars-Sinai Health System, 8723 Alden Dr. SSB-197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; 6d961eade5cca35bb6a5aa35e58c5af9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..789
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350107"
FT   mRNA            join(<1..270,514..>789)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350107"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..>789)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350107"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2D0I6"
FT                   /db_xref="IMGT/HLA:B*35:01:07"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2D0I6"
FT                   /protein_id="ACB56575.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350107"
FT                   /number=2
FT   gap             271..513
FT                   /estimated_length=243
FT   exon            514..789
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*350107"
FT                   /number=3
XX
SQ   Sequence 789 BP; 112 A; 173 C; 187 G; 74 T; 243 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca catcatccag aggatgtatg       540
     gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtcc gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       660
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcct gtgcgtggag tggcttcgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcgg                                                               789
//


spacer
spacer