Dbfetch

ID   EU564105; SV 1; linear; genomic DNA; STD; HUM; 790 BP.
XX
AC   EU564105;
XX
DT   29-APR-2008 (Rel. 95, Created)
DT   29-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B*5817N
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-790
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   "Novel HLA-Class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-790
RA   Lazaro A.M., Xiao Y., Hurley C.K.;
RT   ;
RL   Submitted (13-MAR-2008) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 08507b393af43f491b36c6b4dc3f3ec7.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..790
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00303"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>622
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5817N"
FT                   /note="null allele"
FT   mRNA            join(<1..269,515..>622)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5817N"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..269,515..622)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5817N"
FT                   /product="truncated MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*58:17N"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2LRS6"
FT                   /protein_id="ACC76757.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDGETRNMKASAQTYRENLRSRSATTTRARPGLTSSRGCMAATWGP
FT                   TGASSAGMTSPPTTARITSP"
FT   exon            <1..269
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5817N"
FT                   /number=2
FT   gap             270..514
FT                   /estimated_length=245
FT   exon            515..>622
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5817N"
FT                   /number=3
XX
SQ   Sequence 790 BP; 106 A; 173 C; 193 G; 73 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggtcgc       240
     gctccgctac tacaaccaga gcgaggccgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnggtctc acatcatcca gaggatgtat       540
     ggctgcgacc tggggcccga cgggcgcctc ctccgcgggc atgaccagtc cgcctacgac       600
     ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc ggacaccgcg       660
     gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac       720
     ctggagggcc tgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg       780
     cagcgcgcgg                                                              790
//