spacer

EBI Dbfetch

ID   EU559335; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   EU559335;
XX
DT   08-APR-2008 (Rel. 95, Created)
DT   08-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens isolate CS00002 MHC class I antigen (HLA-A) gene, HLA-A*9241
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Cao K., Wang Q., Duong H., Naim M., Ong G., Reinsmoen N.L.;
RT   "A novel allele of A*020101 variant identified by sequence based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Cao K., Wang Q., Duong H., Naim M., Ong G., Reinsmoen N.L.;
RT   ;
RL   Submitted (11-MAR-2008) to the INSDC.
RL   Comprehensive Transplant Center, Department of Medicine, HLA Laboratory,
RL   Cedars-Sinai Health System, 8723 Alden Dr. SSB-197, Los Angeles, CA 90048,
RL   USA
XX
DR   MD5; 0399409279d4293d0beea2555b309205.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /isolate="CS00002"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9241"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9241"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9241"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2CZD9"
FT                   /db_xref="IMGT/HLA:A*02:141"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2CZD9"
FT                   /protein_id="ACB56638.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIVVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9241"
FT                   /number=2
FT   gap             271..511
FT                   /estimated_length=241
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*9241"
FT                   /number=3
XX
SQ   Sequence 787 BP; 111 A; 160 C; 194 G; 81 T; 241 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgt agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngttctcaca ccgtccagag gatgtatggc       540
     tgcgacgtgg ggtcggactg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       600
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcagct       660
     cagaccacca agcacaagtg ggaggcggcc catgtggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer