spacer

EBI Dbfetch

ID   EU557970; SV 1; linear; genomic DNA; STD; HUM; 1282 BP.
XX
AC   EU557970;
XX
DT   02-APR-2008 (Rel. 95, Created)
DT   04-APR-2008 (Rel. 95, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*26 novel allele, exons
DE   2 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1282
RA   Sung H.Y., Hong S.G., Lee S.M.;
RT   "A novel HLA-A*26 allele, identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-1282
RA   Ahn B.M.;
RT   ;
RL   Submitted (11-MAR-2008) to the INSDC.
RL   Woongbee Meditech, Rm 1309 Biz Center, 190-1 Sangdaewon-1 Dong, Jungwon-Ku,
RL   Seongnam City, Kyunggi-Do 462-721, Rep. of Korea
XX
RN   [3]
RP   1-1282
RA   Lee S.M.;
RT   ;
RL   Submitted (11-MAR-2008) to the INSDC.
RL   Pochon CHA University, 222 Yatop-dong, Bundang-Ku, Seongnam City,
RL   Kyunggi-do 463-836, Rep. of Korea
XX
RN   [4]
RP   1-1282
RA   Sung H.Y., Hong S.G.;
RT   ;
RL   Submitted (11-MAR-2008) to the INSDC.
RL   Bundang Cha Hospital, 351 Yatop-dong, Bundang-Ku, Seongnam City, Kyunggi-do
RL   463-836, Rep. of Korea
XX
DR   MD5; 5a6deb47b60b2eb9cdce06d2248bfd49.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1282
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1282
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT   mRNA            join(<73..342,502..777,997..>1272)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT                   /product="MHC class I antigen"
FT   CDS             join(<73..342,502..777,997..>1272)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2CZA7"
FT                   /db_xref="IMGT/HLA:A*26:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B2CZA7"
FT                   /protein_id="ACB45596.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTHRANLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            73..342
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT                   /number=2
FT   gap             400..499
FT                   /estimated_length=unknown
FT   exon            502..777
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT                   /number=3
FT   gap             834..933
FT                   /estimated_length=unknown
FT   exon            997..1272
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26 novel"
FT                   /number=4
XX
SQ   Sequence 1282 BP; 209 A; 336 C; 379 G; 158 T; 200 other;
     gcgggggcgc aggacccggg aagccgcgcc tggaggaggg tcgggcgggt ctcagccact        60
     cctcgccccc aggctcccac tccatgaggt atttctacac ctccgtgtcc cggcccggcc       120
     gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc gtgcggttcg       180
     acagcgacgc cgcgagccag aggatggagc cgcgggcgcc gtggatagag caggaggggc       240
     cggagtattg ggaccggaac acacggaatg tgaaggccca ctcacagact caccgagcga       300
     acctggggac cctgcgcggc tactacaacc agagcgagga cggtgagtga ccccggcccg       360
     gggcgcaggt cacgacccct catcccccac ggacgggccn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnna ggttctcaca ccatccagag gatgtatggc tgcgacgtgg       540
     ggccggacgg gcgcttcctc cgcgggtacc agcaggacgc ttacgacggc aaggattaca       600
     tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct cagatcaccc       660
     agcgcaagtg ggagacggcc catgaggcgg agcagtggag agcctacctg gagggccggt       720
     gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag cgcacgggta       780
     ccaggggcca cggggcgcct ccctgatcgc ctgtagatct cccgggctgg cctnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntgtgctg gaggagtgtc ccatgacaga       960
     tgcaaaatgc ctgaatgttc tgactcttcc tgacagacgc ccccaagacg catatgactc      1020
     accacgctgt ctctgaccat gaggccaccc tgaggtgctg ggccctgagc ttctaccctg      1080
     cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg      1140
     tggagaccag gcctgcaggg gatgggacct tccagaagtg ggcgtctgtg gtggtgcctt      1200
     ctggacagga gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca      1260
     ccctgagatg gggtaaggag gg                                               1282
//


spacer
spacer