Dbfetch

ID   EU547797; SV 1; linear; genomic DNA; STD; HUM; 1642 BP.
XX
AC   EU547797;
XX
DT   31-MAR-2008 (Rel. 95, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1642
RX   DOI; 10.1111/j.1399-0039.2009.01307.x.
RX   PUBMED; 19624484.
RA   Kim K.W., Kwon O.J., Kwon S.Y., Cho N.S., Oh D.J.;
RT   "A new HLA-B*5124 variant, B*512402 allele, identified by sequence-based
RT   typing";
RL   Tissue Antigens 74(3):253-254(2009).
XX
RN   [2]
RP   1-1642
RA   Kim K.W., Kwon S.Y., Cho N.S., Oh D.J., Kwon O.J.;
RT   ;
RL   Submitted (06-MAR-2008) to the INSDC.
RL   3rd Research Team, Blood Transfusion Research Institute, 164 Pyoung-dong,
RL   Jongno-gu, Seoul 110-747, South Korea
XX
DR   MD5; 98acb73146f6f71affb7c32220986340.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1642
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1642
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT   mRNA            join(<1..270,516..791,1367..>1642)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="IMGT/HLA:B*51:24:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B2CSI1"
FT                   /protein_id="ACB38367.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             792..1366
FT                   /estimated_length=575
XX
SQ   Sequence 1642 BP; 210 A; 348 C; 361 G; 148 T; 575 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gtgctgaccg cggggccggg gccagggtct cacacttggc agacgatgta       540
     tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga aggagacgct       780
     gcagcgcgcg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaccc cccaaagaca      1380
     cacgtgaccc accaccccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac      1500
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg      1560
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg      1620
     aagcccctca ccctgagatg gg                                               1642
//