Dbfetch

ID   EU547493; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EU547493;
XX
DT   31-MAR-2008 (Rel. 95, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*9544 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RX   DOI; 10.1111/j.1399-0039.2010.01533.x.
RX   PUBMED; 20727119.
RA   Dong L., Yan L.N., Xie J.H., An S.P., Yuan Y.H.;
RT   "A new HLA-B*15 variant, B*15:144, identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 76(5):421-422(2010).
XX
RN   [2]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   "A new HLA-B*15 allele detected with SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-786
RA   Yan L.N., An S.P., Li S.Y., Xie J.H., Dong L., Dong Z., Yuan Y.H.;
RT   ;
RL   Submitted (06-MAR-2008) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, No. 424, Huanghe Road, Tianjin
RL   300110, China
XX
DR   MD5; 359b37dead4c268c936fe02885d07eed.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9544"
FT   mRNA            join(<1..270,511..>786)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9544"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,511..>786)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9544"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*15:144"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2CS91"
FT                   /protein_id="ACB36995.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9544"
FT                   /number=2
FT   gap             271..510
FT                   /estimated_length=240
FT   exon            511..786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9544"
FT                   /number=3
FT   variation       705..706
FT                   /gene="HLA-B"
FT                   /replace="ct"
FT                   /note="compared with HLA-B*1502"
XX
SQ   Sequence 786 BP; 112 A; 170 C; 191 G; 73 T; 240 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacat catccagagg atgtatggct       540
     gcgacgtggg gccggacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       600
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       660
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       720
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       780
     gcgcgg                                                                  786
//