Dbfetch

ID   EU517717; SV 1; linear; genomic DNA; STD; HUM; 884 BP.
XX
AC   EU517717;
XX
DT   26-MAR-2008 (Rel. 95, Created)
DT   17-JUL-2010 (Rel. 105, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*45 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-884
RX   PUBMED; 20403139.
RA   Veiga T.R., Rampim G.F., Gerbase De Lima M.;
RT   "Identification of two novel HLA-B alleles in the Brazilian population:
RT   B*4509 and B*5212";
RL   Tissue Antigens 76(2):153-154(2010).
XX
RN   [2]
RP   1-884
RA   Veiga T.R., Rampim G.F., Gerbase-DeLima M.;
RT   ;
RL   Submitted (23-FEB-2008) to the INSDC.
RL   Pediatrics - Immunogenetics Division, Federal University of Sao Paulo,
RL   Loefgreen 1235, Sao Paulo, SP 04040031, Brazil
XX
DR   MD5; bfd83fdf7f24d432dac66b194faf9ea8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..884
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>884
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*45 variant"
FT   mRNA            join(<72..341,592..>867)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*45 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<72..341,592..>867)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*45 variant"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*45:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2CJ99"
FT                   /protein_id="ACB20808.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            72..341
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*45 variant"
FT                   /number=2
FT   exon            592..867
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*45 variant"
FT                   /number=3
FT   variation       657
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared to HLA-B*4502"
FT   variation       660
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="compared to HLA-B*4502"
FT   variation       667
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared to HLA-B*4502"
XX
SQ   Sequence 884 BP; 152 A; 296 C; 326 G; 110 T; 0 other;
     cgggggcgca ggacccgggg agccgcgccg ggaggagggt cgggcgggtc tcagcccctc        60
     ctcgccccca ggctcccact ccatgaggta tttccacacc gccatgtccc ggcccggccg       120
     cggggagccc cgcttcatca ccgtgggcta cgtggacgac acgctgttcg tgaggttcga       180
     cagcgacgcc acgagtccga ggaaggagcc gcgggcgcca tggatagagc aggaggggcc       240
     ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt accgagagag       300
     cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       360
     ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga gtctccgggt       420
     ccgagatccg cccccctgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc       480
     aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcgggg       540
     cggggcgggg cggggctcgg gggacggggc tgaccgcggg gcctgggcca gggtctcaca       600
     cttggcagag gatgtatggc tgcgacctgg ggcccgacgg gcgcctcctc cgcgggcatg       660
     accagtccgc ctacgacggc aaggattaca tcgccctgaa cgaggacctg agctcctgga       720
     ccgcggcgga caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg       780
     agcaggacag agcctacctg gagggcctgt gcgtggagtc gctccgcaga tacctggaga       840
     acgggaagga gacgctgcag cgcgcgggta ccaggggcag tggg                        884
//