Dbfetch

ID   EU517716; SV 1; linear; genomic DNA; STD; HUM; 881 BP.
XX
AC   EU517716;
XX
DT   26-MAR-2008 (Rel. 95, Created)
DT   17-JUL-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*52 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-881
RX   PUBMED; 20403139.
RA   Veiga T.R., Rampim G.F., Gerbase De Lima M.;
RT   "Identification of two novel HLA-B alleles in the Brazilian population:
RT   B*4509 and B*5212";
RL   Tissue Antigens 76(2):153-154(2010).
XX
RN   [2]
RP   1-881
RA   Veiga T.R., Rampim G.F., Gerbase-DeLima M.;
RT   ;
RL   Submitted (22-FEB-2008) to the INSDC.
RL   Pediatrics - Immunogenetics Division, Federal University of Sao Paulo,
RL   Loefgreen 1235, Sao Paulo, SP 04040031, Brazil
XX
DR   MD5; 6d15ac3ba697ca5002eed6b95b63633f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..881
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>881
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT   mRNA            join(<72..341,587..>862)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<72..341,587..>862)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /product="MHC class I antigen"
FT                   /note="antigen presenting molecule"
FT                   /db_xref="IMGT/HLA:B*52:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2CJ98"
FT                   /protein_id="ACB20807.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            72..341
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /number=2
FT   exon            587..862
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52 variant"
FT                   /number=3
FT   variation       655
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="compared to HLA-B*520101"
XX
SQ   Sequence 881 BP; 155 A; 293 C; 321 G; 112 T; 0 other;
     cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc tcagcccctc        60
     ctcgccccca ggctcccact ccatgaggta tttctacacc gccatgtccc ggcccggccg       120
     cggggagccc cgcttcatcg cagtgggcta cgtggacgac acccagttcg tgaggttcga       180
     cagcgacgcc gcgagtccga ggacggagcc ccgggcgcca tggatagagc aggaggggcc       240
     ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt accgagagaa       300
     cctgcggatc gcgctccgct actacaacca gagcgaggcc ggtgagtgac cccggcccgg       360
     ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga gtctccgggt       420
     ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg cgagagcccc       480
     aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg ttggtcgggg       540
     cggggcgggg ctcgggggac ggtgctgacc gcggggccgg ggccagggtc tcacacttgg       600
     cagacgatgt atggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag       660
     tacgcctacg acggcaaaga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg       720
     gcggacaccg cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag       780
     ctgagagcct acctggaggg cctgtgcgtg gagtggctcc gcagacacct ggagaacggg       840
     aaggagacgc tgcagcgcgc gggtaccagg ggcagtgggg a                           881
//