spacer

EBI Dbfetch

ID   EU492459; SV 1; linear; genomic DNA; STD; HUM; 1845 BP.
XX
AC   EU492459;
XX
DT   11-MAR-2008 (Rel. 95, Created)
DT   27-OCT-2009 (Rel. 102, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11 new allele, exons 1
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1845
RX   DOI; 10.1111/j.1399-0039.2009.01338.x.
RX   PUBMED; 19845898.
RA   Li Z., Zou H.Y., Wang D.M., Cheng X.;
RT   "A novel allele, HLA-A*110203, was identified in a Chinese individual";
RL   Tissue Antigens 74(5):434-435(2009).
XX
RN   [2]
RP   1-1845
RA   Li Z., Zou H.-Y., Cheng L.-H.;
RT   ;
RL   Submitted (16-FEB-2008) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 89b23a68ab8a6a749dae9b5b990ded94.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1845
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT   mRNA            join(<1..73,204..473,715..990,1570..>1845)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..>1845)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1PT16"
FT                   /db_xref="IMGT/HLA:A*11:02:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1PT16"
FT                   /protein_id="ACA58086.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGKPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /number=3
FT   exon            1570..>1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 new"
FT                   /number=4
FT   variation       1622
FT                   /gene="HLA-A"
FT                   /replace="c"
FT                   /note="compared to HLA-A*1102"
XX
SQ   Sequence 1845 BP; 344 A; 573 C; 608 G; 320 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttctaca cctccgtgtc       240
     ccggcccggc cgcgggaagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtggccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcc gggcagggct tgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gcccatgcgg       900
     cggagcagca gagagcctac ctggagggcc ggtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtctctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct caggggatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ctctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggg                      1845
//


spacer
spacer