spacer

EBI Dbfetch

ID   EU482038; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU482038;
XX
DT   04-MAR-2008 (Rel. 95, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4084 allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   He J., Qiu Q., Bao X., Yuan X., Cen J., Chen Z.;
RT   "Homo sapiens MHC class I antigen (HLA-B gene), exon 2";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   He J., Qiu Q., Bao X., Yuan X., Cen J., Chen Z.;
RT   ;
RL   Submitted (12-FEB-2008) to the INSDC.
RL   The First Affiliated Hospital of Soochow University, Jiangsu Institute of
RL   Hematology, 188 Shizi Street, Suzhou, Jiangsu 215006, P.R.China
XX
DR   MD5; 286282b13d7d2c8c269653e99400603c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4084"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4084"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1PN79"
FT                   /db_xref="IMGT/HLA:B*40:84"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B1PN79"
FT                   /protein_id="ACA48229.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYSDRETQISKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4084"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 88 C; 87 G; 35 T; 0 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattcgg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer