spacer

EBI Dbfetch

ID   EU445580; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU445580;
XX
DT   01-MAR-2008 (Rel. 95, Created)
DT   01-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*03 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Vigh A., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-DRB1*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Vigh A., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (06-FEB-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
DR   MD5; 87ba0af7a64664867045ea80c8f70f7d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:B1PL08"
FT                   /db_xref="IMGT/HLA:DRB1*03:50"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:B1PL08"
FT                   /protein_id="ACA28738.1"
FT                   /translation="GFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*03 variant"
FT                   /number=2
FT   variation       3
FT                   /gene="HLA-DRB1"
FT                   /replace="c"
FT                   /note="compared to HLA-DRB1*030101; results in glycine to
FT                   arginine substitution"
XX
SQ   Sequence 270 BP; 59 A; 63 C; 99 G; 49 T; 0 other;
     caggtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer