Dbfetch

ID   EU445578; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   EU445578;
XX
DT   01-MAR-2008 (Rel. 95, Created)
DT   01-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*04 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Vigh A., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-Cw*04 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Vigh A., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (06-FEB-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
DR   MD5; 7146243d660860201dd6bd913bfdf17b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*04:35"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B1PL06"
FT                   /protein_id="ACA28736.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DRRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /number=3
FT   variation       564
FT                   /gene="HLA-Cw"
FT                   /replace="g"
FT                   /note="compared to HLA-Cw*04010101; results in arginine to
FT                   glycine substitution"
XX
SQ   Sequence 792 BP; 144 A; 259 C; 282 G; 107 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccc gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcgggac tggggcgggg       480
     ctcgggggac cgggctgacc acgggggcgg ggccagggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gaccggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//