spacer

EBI Dbfetch

ID   EU445574; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   EU445574;
XX
DT   01-MAR-2008 (Rel. 95, Created)
DT   01-MAR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*03 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Vigh A., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-A*03 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Vigh A., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (05-FEB-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
DR   MD5; c605905c70a2d24b1e6e6ba60810eafb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03 variant"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1PL02"
FT                   /db_xref="IMGT/HLA:A*03:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1PL02"
FT                   /protein_id="ACA28732.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTC
FT                   MEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03 variant"
FT                   /number=2
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*03 variant"
FT                   /number=3
FT   variation       729
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to HLA-A*03010101"
FT   variation       733
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="compared to HLA-A*03010101; results in methionine to
FT                   valine substitution"
XX
SQ   Sequence 787 BP; 144 A; 247 C; 283 G; 113 T; 0 other;
     gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggccgggg gcgcaggtca       300
     ggacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggctggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc ggcaggacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcacca agcgcaagtg ggaggcggcc catgaggcgg agcagttgag agcctacctg       720
     gatggcacct gcatggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer