spacer

EBI Dbfetch

ID   EU445482; SV 1; linear; genomic DNA; STD; HUM; 2917 BP.
XX
AC   EU445482;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*340101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2917
RX   DOI; 10.1111/j.1744-313X.2009.00874.x.
RX   PUBMED; 19735485.
RA   Zhu F., He Y., Zhang W., He J., He J., Xu X., Yan L.;
RT   "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese
RT   Han population";
RL   Int. J. Immunogenet. 36(6):351-360(2009).
XX
RN   [2]
RP   1-2917
RA   Yan L., Zhu F., He Y.;
RT   ;
RL   Submitted (05-FEB-2008) to the INSDC.
RL   Blood Center of Zhejiang Province, Blood Transfusion Research, Wulin Road
RL   345, Hangzhou, Zhejiang Province 310016, China
XX
DR   MD5; 9ebf6151c0336af87ec00c73670641bc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2917
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2917
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT   mRNA            join(<1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..>2917)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1591..1866,1966..2082,
FT                   2521..2553,2696..2743,2913..2917)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1PKZ1"
FT                   /db_xref="IMGT/HLA:A*34:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1PKZ1"
FT                   /protein_id="ACA35002.1"
FT                   /translation="MAIMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRKVKAQSQTDRVDLGT
FT                   LRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGILAGLVLFGAVIAGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=3
FT   exon            1591..1866
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=4
FT   exon            1966..2082
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=5
FT   exon            2521..2553
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=6
FT   exon            2696..2743
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=7
FT   exon            2913..2917
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*340101"
FT                   /number=8
XX
SQ   Sequence 2917 BP; 564 A; 835 C; 911 G; 607 T; 0 other;
     atggccatca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaag       120
     gggcccgccc ggcgggggcg caggacccgg gaagccgcgc ctggaggagg gtcgggcggg       180
     tctcagccac tcctcgcccc caggctccca ctccatgagg tatttctaca cctccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccggaa cacacggaaa gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcg gggcggggct cgggggaccg ggctgacctc ggggtccggg ccaggttctc       720
     acaccatcca gaggatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accagcagga cgcttacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggagacg gcccatgagg       900
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1260
     accggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1320
     caatgtgtgt gggggtctga gtccagcact tctgagtccc tcagcctcca ctcaggtcag      1380
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1440
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1500
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1560
     atgcctgaat gttctgactc ttcctgacag acgcccccaa gacacatatg actcaccacg      1620
     ctgtctctga ccatgaggcc accctgaggt gctgggccct gagcttctac cctgcggaga      1680
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1740
     ccaggcctgc aggggatgga accttccaga agtgggcgtc tgtggtggtg ccttctggac      1800
     aggagcagag atacacctgc catgtgcagc atgagggtct gcccaagccc ctcaccctga      1860
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      1920
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      1980
     ccaccatccc catcgtgggc atccttgctg gcctggttct ctttggagct gtgatcgctg      2040
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa gggatgaagg      2100
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2160
     cctcgttact gggaagcacc atccacaatt atgagcctac ccagcctggg ccctgtgtgc      2220
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2280
     acggcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2340
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcctgc      2400
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2460
     tctaggacct taaggccctg gctcctttct ggtatctcac aggacatttt cttcccacag      2520
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2580
     ggtccttggg atattgtgtt tgggagcccg tgggggagct cacccacccc acaattcctc      2640
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgtcctac cccaggcagt      2700
     gacagtgccc agggctctga tatgtctctc acagcttgta aaggtgagag cctggagggc      2760
     ctgatgtgtg ttgggtgttg ggcggaacag tggacgcagc tgtgctatgg ggtttctttg      2820
     cattggatgt attgagcatg caatgggctg tttaaagtgt gactcctcac tgtgacagat      2880
     acgaatttgt tcatgaatat ttttttctat agtgtga                               2917
//


spacer
spacer