spacer

EBI Dbfetch

ID   EU445478; SV 2; linear; genomic DNA; STD; HUM; 2903 BP.
XX
AC   EU445478;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*300101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2903
RX   DOI; 10.1111/j.1744-313X.2009.00874.x.
RX   PUBMED; 19735485.
RA   Zhu F., He Y., Zhang W., He J., He J., Xu X., Yan L.;
RT   "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese
RT   Han population";
RL   Int. J. Immunogenet. 36(6):351-360(2009).
XX
RN   [2]
RP   1-2903
RA   Yan L., Zhu F., He Y.;
RT   ;
RL   Submitted (05-FEB-2008) to the INSDC.
RL   Blood Center of Zhejiang Province, Blood Transfusion Research, Wulin Road
RL   345, Hangzhou, Zhejiang Province 310016, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-2903
RA   Yan L., Zhu F., He Y.;
RT   ;
RL   Submitted (04-SEP-2009) to the INSDC.
RL   Blood Center of Zhejiang Province, Blood Transfusion Research, Wulin Road
RL   345, Hangzhou, Zhejiang Province 310016, China
XX
DR   MD5; f36abf9b1b180595b898341891bf3413.
XX
CC   On Sep 4, 2009 this sequence version replaced gi:168831481.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2903
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2903
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..>2903)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..2064,
FT                   2507..2539,2682..2729,2899..2903)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q2LC93"
FT                   /db_xref="IMGT/HLA:A*30:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q2LC93"
FT                   /protein_id="ACA34998.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFSTSVSRPGSGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGT
FT                   LRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARWAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=2
FT   exon            715..990
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=3
FT   exon            1570..1845
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=4
FT   exon            1948..2064
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=5
FT   exon            2507..2539
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=6
FT   exon            2682..2729
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=7
FT   exon            2899..2903
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*300101"
FT                   /number=8
XX
SQ   Sequence 2903 BP; 562 A; 822 C; 906 G; 613 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcggtcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ccggcccggc agtggagagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       360
     gcaggagagg cctgagtatt gggaccagga gacacggaat gtgaaggccc agtcacagac       420
     tgaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccg ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgacccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatt cccccgggtt       660
     ggtcggggct gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccatcca gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       780
     atgaacagca cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggcg gctcagatca cccagcgcaa gtgggaggcg gcccgttggg       900
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg ccttcctgat      1020
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc tgtcttccca gcccaccatc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgccg      2040
     tgatgtggag gaggaagagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2100
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2160
     accatccaca atcatgggcc tacccagcct gggccctgtg tgccagcact tactcttttg      2220
     taaagcacct gttaaaatga aggacagatt tatcaccttg attacggcgg tgatgggacc      2280
     tgatcccagc agtcacaagt cacaggggaa ggtccctgag gacagacctc aggagggcta      2340
     ttggtccagg acccacacct gctttcttca tgtttcctga tcccgccctg ggtctgcagt      2400
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2460
     gccctggctc ctttctggta tctcacagga cattttcttc tcacagatag aaaaggaggg      2520
     agttacactc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2580
     tgtgtttggg agcccatggg ggagctcacc caccccacaa ttcctcctct agccacatct      2640
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      2700
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gaggacctaa tgtgtgttgg      2760
     gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttgcatt ggatgtattg      2820
     agcatgcgat gggctgttta aggtgtgacc cctcactgtg atggatatga atttgttcat      2880
     gaatattttt ttctatagtg tga                                              2903
//


spacer
spacer