spacer

EBI Dbfetch

ID   EU445477; SV 1; linear; genomic DNA; STD; HUM; 2918 BP.
XX
AC   EU445477;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*29010101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2918
RX   DOI; 10.1111/j.1744-313X.2009.00874.x.
RX   PUBMED; 19735485.
RA   Zhu F., He Y., Zhang W., He J., He J., Xu X., Yan L.;
RT   "Analysis of the complete genomic sequence of HLA-A alleles in the Chinese
RT   Han population";
RL   Int. J. Immunogenet. 36(6):351-360(2009).
XX
RN   [2]
RP   1-2918
RA   Yan L., Zhu F., He Y.;
RT   ;
RL   Submitted (05-FEB-2008) to the INSDC.
RL   Blood Center of Zhejiang Province, Blood Transfusion Research, Wulin Road
RL   345, Hangzhou, Zhejiang Province 310016, China
XX
DR   MD5; dfda709351cee4ab637c687a7d06fb07.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2918
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2918
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT   mRNA            join(<1..73,203..472,714..989,1590..1865,1965..2081,
FT                   2522..2554,2697..2744,2914..>2918)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,714..989,1590..1865,1965..2081,
FT                   2522..2554,2697..2744,2914..2918)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q6EXB0"
FT                   /db_xref="IMGT/HLA:A*29:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6EXB0"
FT                   /protein_id="ACA34997.1"
FT                   /translation="MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGT
FT                   LRGYYNQSEAGSHTIQMMYGCHVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVFAGAVVAAVRWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDMSLTACKV"
FT   exon            1..73
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=1
FT   exon            203..472
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=2
FT   exon            714..989
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=3
FT   exon            1590..1865
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=4
FT   exon            1965..2081
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=5
FT   exon            2522..2554
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=6
FT   exon            2697..2744
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=7
FT   exon            2914..2918
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29010101"
FT                   /number=8
XX
SQ   Sequence 2918 BP; 555 A; 832 C; 913 G; 618 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct tgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcgtg gggaaaccgc ctctgcgggg agaagcaagg       120
     ggcccgcccg gcggggacgc aggacccggg tagccgcgcc gggaggaggg tcgggtgggt       180
     ctcagccact cctcgccccc aggctcccac tccatgaggt atttcaccac atccgtgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc gccgtgggct acgtggacga cacgcagttc       300
     gtgcggtttg acagcgacgc cgcgagccag aggatggagc cgcgggcacc gtggatagag       360
     caggaggggc cggagtattg ggacctgcag acacggaatg tgaaggccca gtcacagact       420
     gaccgagcga acctggggac cctgcgcggc tactacaacc agagcgaggc cggtgagtga       480
     ccccggcccg gggcgcaggt cacgacctct catcccccac ggacgggccg ggtcgcccac       540
     agtctccggg tccgagatcc accccgaagc cgcgggaccc cgagaccctt gccccgggag       600
     aggcccaggc gcctttaccc ggtttcattt tcagtttagg ccaaaaatcc ccccgggttg       660
     gtcggggccg gacggggctc gggggactgg gctgaccgtg gggtcggggc caggttctca       720
     caccatccag atgatgtatg gctgccacgt ggggtcggac gggcgcttcc tccgcgggta       780
     ccggcaggac gcctacgacg gcaaggatta catcgccttg aacgaggacc tgcgctcttg       840
     gaccgcggcg gacatggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc       900
     ggagcagttg agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga       960
     gaacgggaag gagacgctgc agcgcacggg taccgggggc cacggggcgc ctccctgatc      1020
     gcctgtagat ctcccgggct ggcctcccac aaggagggga gacaattggg accaacacta      1080
     gaatatcgcc ctccctctgg tcctgaggga gaggaatcct cctgggtttc cagatcctgt      1140
     accagagagt gactctgagg ttccgccctg ctctctgaca caattaaggg ataaaatctc      1200
     tgaaggaatg acgggaagac gatccctcga atactgatga gtggttccct ttgacacaca      1260
     ccggcagcag ccttgggccc gtgacttttc ctctcaggcc ttgttctctg cttcacactc      1320
     aatgtgtgtg ggggtctgag tccagcactt ctgagtccct cagcctccac tcaggtcagg      1380
     accagaagtc gctgttccct cttcagggac tagaattttc cacggaatag gagattatcc      1440
     caggtgcctg tgtccaggct ggtgtctggg ttctgtgctc ccttccccat cccaggtgtc      1500
     ctgtccattc tcaagatagc cacatgtgtg ctggaggagt gtcccatgac agatgcaaaa      1560
     tgcctgaatg ttctgactct tcctgacaga cgcccccaag acgcatatga ctcaccacgc      1620
     tgtctctgac catgaggcca ccctgaggtg ctgggccctg agcttctacc ctgcggagat      1680
     cacactgacc tggcagcggg atggggagga ccagacccag gacacggagc ttgtggagac      1740
     caggcctgca ggggatggaa ccttccagaa gtgggcgtct gtggtggtgc cttctggaca      1800
     ggagcagaga tacacctgcc atgtgcagca tgagggtctg cccaagcccc tcaccctgag      1860
     atggggtaag gagggagatg ggggtgtcat gtcttttagg gaaagcagga gcctctctga      1920
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccgt cttcccagcc      1980
     caccatcccc atcgtgggca tcattgctgg cctagttctc tttggagctg tgttcgctgg      2040
     agctgtggtc gctgctgtga ggtggaggag gaagagctca ggtggggtga agggatgaag      2100
     ggtgggtctg agatttcttg tctcactgag ggttccaaga cccaggtaga agtgtgccct      2160
     gcctcgttac tgggaagcac catccacaat tatgggccta cccagcctgg gccctgtgtg      2220
     ccagcactta ctcttttgta aagcacctgt taaaatgaag gacagattta tcaccttgat      2280
     tacggcggtg atgggacctg atcccagcag tcacaagtca caggggaagg tccctgagga      2340
     ccttcaggag ggcggttggt ccaggaccca cacctgcttt cttcatgttt cctgatcccg      2400
     ccctgggtct gcagtcacac atttctggaa acttctctga ggtccaagac ttggaggttc      2460
     ctctaggacc ttaaggccct ggctcctttc tggtatctca caggacattt tcttcccaca      2520
     gatagaaaag gagggagcta ctctcaggct gcaagtaagt atgaaggagg ctgatgcctg      2580
     aggtccttgg gatattgtgt ttgggagccc gtgggggagc tcacccaccc cacaattcct      2640
     cctctagcca catcttctgt gggatctgac caggttctgt ttttgtccta ccccaggcag      2700
     tgacagtgcc cagggctctg atatgtctct cacagcttgt aaaggtgaga gcctggaggg      2760
     cctgatgtgt gttgggtgtt gggcggaaca gtggacgcag ctgtgctatg gggtttcttt      2820
     gcattggatg tattgagcat gcgatgggct gtttaaagtg tgactcctca ctgtgacaga      2880
     tacgaatttg ttcatgaata tttttttcta tagtgtga                              2918
//


spacer
spacer