spacer

EBI Dbfetch

ID   EU442891; SV 1; linear; genomic DNA; STD; HUM; 1288 BP.
XX
AC   EU442891;
XX
DT   02-MAR-2008 (Rel. 95, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*03 new allele, exons
DE   1 through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1288
RX   DOI; 10.1111/j.1399-0039.2009.01250.x.
RX   PUBMED; 19392803.
RA   Zou H.Y., Li Z., Deng Z.H.;
RT   "Characterization of a new HLA-C allele in a Chinese family by
RT   sequence-based typing: HLA-Cw*0348";
RL   Tissue Antigens 73(6):616-618(2009).
XX
RN   [2]
RP   1-1288
RA   Zou H.-Y., Li Z., Cheng L.-H., Jin S.-Z.;
RT   ;
RL   Submitted (03-FEB-2008) to the INSDC.
RL   Shenzhen Blood Center, Nigang West Road, Shenzhen, Guangdong 518035, China
XX
DR   MD5; 4e08adfd021ba99005d093aed3434fd4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1288
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>994
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT   mRNA            join(<1..73,204..473,719..>994)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,719..>994)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1PK97"
FT                   /db_xref="IMGT/HLA:C*03:48"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1PK97"
FT                   /protein_id="ACA35050.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFYTAVSRPGRGEPH
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGLEYWDRETQKYKRQAQTDRVSLRN
FT                   LRGYYNQSEAGSHIIQRMYGCDVGPDGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLKNGKETLQRA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /number=1
FT   exon            204..473
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /number=2
FT   variation       372
FT                   /gene="HLA-Cw"
FT                   /replace="c"
FT                   /note="compared to allele HLA-Cw*0304"
FT   variation       673^674
FT                   /gene="HLA-Cw"
FT                   /replace="t"
FT                   /note="compared to allele HLA-Cw*0304"
FT   exon            719..>994
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /number=3
XX
SQ   Sequence 1288 BP; 232 A; 398 C; 457 G; 201 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgacc        60
     gagacctggg ccggtgagtg cggggttggg agggaatcgg cctctgcgga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagcccc tcctcgcccc caggctccca ctccatgagg tatttctaca ccgctgtgtc       240
     ccggcccggc cgcggggagc cccacttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc gagaggggag ccgcgggcgc cgtgggtgga       360
     gcaggagggg ctggagtatt gggaccggga gacacagaag tacaagcgcc aggcacagac       420
     tgaccgagtg agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcctcatccc ccacggacgg cccgggtcgc       540
     cccaagtctc ccggtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg ggcggggcgg ggctcggggg acggggctga ccgcgggggc ggggccaggg       720
     tctcacatca tccagaggat gtatggctgc gacgtggggc ccgacgggcg cctcctccgc       780
     gggtatgacc agtacgccta cgacggcaag gattacatcg ccctgaacga ggatctgcgc       840
     tcctggaccg ccgcggacac ggcggctcag atcacccagc gcaagtggga ggcggcccgt       900
     gaggcggagc agctgagagc ctacctggag ggcctgtgcg tggagtggct ccgcagatac       960
     ctgaagaatg ggaaggagac gctgcagcgc gcgggtacca ggggcagtgg ggagccttcc      1020
     ccatctcctg tagatctccc gggatggcct cccacgagga ggggaggaaa atgggatcag      1080
     cgctagaata tcgccctccc ttgaatggag aatgggatga gttttcctga gtttcctctg      1140
     agggccccct ctgctctcta ggacaattaa gggatgaagt ccttgaggaa atggagggga      1200
     agacagtccc tagaatactg atcaggggtc ccctttgacc actttgacca ctgcagcagc      1260
     tgtggtcagg ctgctgacct ttctctca                                         1288
//


spacer
spacer