spacer

EBI Dbfetch

ID   EU434882; SV 1; linear; genomic DNA; STD; HUM; 1640 BP.
XX
AC   EU434882;
XX
DT   21-FEB-2008 (Rel. 94, Created)
DT   08-AUG-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1640
RX   DOI; 10.1111/j.1399-0039.2008.01063.x.
RX   PUBMED; 18721280.
RA   Han S.H., Heo Y.A., Kwon O.J., Lee A., Lee K.R.;
RT   "A new HLA-B*40 allele, HLA-B*4085, identified by sequence-based typing in
RT   the Korean population";
RL   Tissue Antigens 72(2):179-180(2008).
XX
RN   [2]
RP   1-1640
RA   Han S., Kwon O.;
RT   ;
RL   Submitted (30-JAN-2008) to the INSDC.
RL   Molecular Genetics, SMSI, 7-14, Dongbinggo-dong, Yongsan-gu, Seoul 140-809,
RL   Korea
XX
DR   MD5; c0b1647b76eb5704f982eb95fc3f594a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1640
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1640
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT   mRNA            join(<1..270,514..789,1365..>1640)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,514..789,1365..>1640)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1AA54"
FT                   /db_xref="IMGT/HLA:B*40:85"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1AA54"
FT                   /protein_id="ACA09721.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQIIQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             271..513
FT                   /estimated_length=243
FT   gap             790..1364
FT                   /estimated_length=575
XX
SQ   Sequence 1640 BP; 180 A; 257 C; 272 G; 113 T; 818 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnggtctca caccctccag agcatgtacg       540
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac gcctacgacg       600
     gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgccgcg gacacggcgg       660
     ctcagatcat ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       720
     tggagggcga gtgcgtggag tggctccgca gatacctgga gaacgggaag gagacgctgc       780
     agcgcgcggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnaccccc caaagacaca      1380
     cgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg ccctgggctt      1440
     ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa ctcaggacac      1500
     tgagcttgtg gagaccagac cagcaggaga tagaaccttc cagaagtggg cagctgtggt      1560
     ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg ggctgccgaa      1620
     gcccctcacc ctgagatggg                                                  1640
//


spacer
spacer