spacer

EBI Dbfetch

ID   EU431984; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   EU431984;
XX
DT   16-FEB-2008 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen gene, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Vigh A., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-Cw*07 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Vigh A., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (29-JAN-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
DR   MD5; 4dd2ad9efc6525b46c510ddb115ebccb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,517..>792)
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1A9K4"
FT                   /db_xref="IMGT/HLA:C*16:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1A9K4"
FT                   /protein_id="ABZ89502.1"
FT                   /translation="SHSMRYFYTAVSQPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /number=2
FT   variation       40
FT                   /replace="g"
FT                   /note="compared to HLA-Cw*160101; results in glutamine to
FT                   arginine substitution"
FT   exon            517..792
FT                   /number=3
XX
SQ   Sequence 792 BP; 140 A; 265 C; 284 G; 103 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtccca gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc ccatccccca cggacggccc gggtcgcccc gagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcggccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcggggc tggggcgggg       480
     ctcgcgggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagtggatgt       540
     atggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgc ggcggagcag cagagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer