spacer

EBI Dbfetch

ID   EU410615; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   EU410615;
XX
DT   16-FEB-2008 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen gene, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Vigh A., Hirv K., Mytilineos J.;
RT   "Characterization of a new HLA-Cw*07 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Vigh A., Hirv K., Mytilineos J.;
RT   ;
RL   Submitted (18-JAN-2008) to the INSDC.
RL   Transplantation Immunology, Institute for Clinical Transfusion Medicine and
RL   Immunogenetics, Helmholtzstr. 10, Ulm 89081, Germany
XX
DR   MD5; 17adc310827ae5b5a80ff0ed372cebc4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..270,516..>791)
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>791)
FT                   /codon_start=3
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B1A0K4"
FT                   /db_xref="IMGT/HLA:B*07:63"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B1A0K4"
FT                   /protein_id="ABZ89498.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRDE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /number=2
FT   variation       134
FT                   /replace="g"
FT                   /note="compared to HLA-B*070201; results in aspartic acid
FT                   to glycine substitution"
FT   exon            516..791
FT                   /number=3
XX
SQ   Sequence 791 BP; 141 A; 264 C; 284 G; 102 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agacgagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggact gggctgaccg cggggccggg gccagggtct cacaccctcc agagcatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt acgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg cggacacggc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagc ggagagccta       720
     cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga aggacaagct       780
     ggagcgcgct g                                                            791
//


spacer
spacer