spacer

EBI Dbfetch

ID   EU399237; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EU399237;
XX
DT   13-FEB-2008 (Rel. 94, Created)
DT   29-SEP-2010 (Rel. 106, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*33:14 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2008.01042.x.
RX   PUBMED; 18380773.
RA   Lee K.W., Huh J.W., Seong C.M.;
RT   "A new HLA-A*33 variant, HLA-A*3314, identified in a Korean individual";
RL   Tissue Antigens 71(6):570-570(2008).
XX
RN   [2]
RP   1-646
RA   Lee K.W.;
RT   ;
RL   Submitted (13-JAN-2008) to the INSDC.
RL   Hallym Institute for Genome Application, Hallym University, 896
RL   Pyungchon-Dong, Dongan-Gu, Anyang, Kyungki-Do 431-070, Korea
XX
DR   MD5; d155123da7b9395b728971b3459fbe08.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33:14"
FT                   /note="similar to HLA-A33 allele"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33:14"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33:14"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B0ZSE7"
FT                   /db_xref="IMGT/HLA:A*33:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0ZSE7"
FT                   /protein_id="ABY90131.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRGPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33:14"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*33:14"
FT                   /number=3
XX
SQ   Sequence 646 BP; 107 A; 162 C; 198 G; 79 T; 100 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggggccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca gcaggacgcc tacgacggca aggattacat cgccttgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer