Dbfetch

ID   EU382733; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   EU382733;
XX
DT   11-MAR-2008 (Rel. 95, Created)
DT   30-AUG-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0401 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RX   DOI; 10.1111/j.1399-0039.2009.01278.x.
RX   PUBMED; 19500316.
RA   Han S.H., Heo Y.A., Kwon O.J., Yoon H.R., Lee K.R.;
RT   "Identification of a novel HLA-Cw*04 allele, HLA-Cw*040106, by
RT   sequence-based typing in the Korean population";
RL   Tissue Antigens 74(3):256-257(2009).
XX
RN   [2]
RP   1-792
RA   Han S.-H., Hur Y., Kwon O.-J.;
RT   "Novel Cw*0401 variant allele";
RL   Unpublished.
XX
RN   [3]
RP   1-792
RA   Han S.-H., Hur Y., Kwon O.-J.;
RT   ;
RL   Submitted (08-JAN-2008) to the INSDC.
RL   Molecular Genetics, SMSI, 7-14 Dongbinggo-dong, Yongsan-gu, Seoul 140-809,
RL   Korea
XX
DR   MD5; d3385e9ba4b55fd81bedb4772b4c2cde.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0401 variant"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0401 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0401 variant"
FT                   /product="MHC class I antigen"
FT                   /note="leukocyte antigen C"
FT                   /db_xref="IMGT/HLA:C*04:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B1PC45"
FT                   /protein_id="ABY86898.1"
FT                   /translation="SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0401 variant"
FT                   /number=2
FT   gap             271..516
FT                   /estimated_length=246
FT   exon            517..>792
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0401 variant"
FT                   /number=3
XX
SQ   Sequence 792 BP; 108 A; 165 C; 199 G; 74 T; 246 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcctg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggagccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc tcacaccctc cagaggatgt       540
     ttggctgcga cctggggccg gacgggcgcc tcctccgcgg gtataaccag ttcgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg atctgcgctc ctggaccgcc gcggacacgg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacttgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//