spacer

EBI Dbfetch

ID   EU378915; SV 1; linear; genomic DNA; STD; HUM; 1105 BP.
XX
AC   EU378915;
XX
DT   01-APR-2009 (Rel. 100, Created)
DT   01-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B15) gene, HLA-B15-related allele,
DE   exons 1 through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1105
RA   Johnson F.B.;
RT   "H. sapiens HLA-B15-related novel allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1105
RA   Johnson F.B.;
RT   ;
RL   Submitted (08-JAN-2008) to the INSDC.
RL   Pathology and Laboratory Medicine, University of Pennsylvania, 405A Stellar
RL   Chance Labs, 422 Curie Blvd, Philadelphia, PA 19104, USA
XX
DR   MD5; cca9e6a7cb8f1c72b58810071b9205a3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1105
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>923
FT                   /gene="HLA-B15"
FT                   /allele="HLA-B15-related"
FT   CDS             join(<1..3,133..402,648..>923)
FT                   /codon_start=3
FT                   /gene="HLA-B15"
FT                   /allele="HLA-B15-related"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:C1ICA6"
FT                   /db_xref="IMGT/HLA:B*15:141"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:C1ICA6"
FT                   /protein_id="ACB13199.1"
FT                   /translation="GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRM
FT                   APRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQTMYGCDVG
FT                   PDGRLLRGHDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGL
FT                   CVEWLRRYLENGKETLQRA"
FT   exon            <1..3
FT                   /gene="HLA-B15"
FT                   /allele="HLA-B15-related"
FT                   /number=1
FT   exon            133..402
FT                   /gene="HLA-B15"
FT                   /allele="HLA-B15-related"
FT                   /number=2
FT   exon            648..923
FT                   /gene="HLA-B15"
FT                   /allele="HLA-B15-related"
FT                   /number=3
XX
SQ   Sequence 1105 BP; 196 A; 352 C; 401 G; 156 T; 0 other;
     ccggtgagtg cggggtcggc agggaaatgg cctctgtggg gaggagcgag gggaccgcag        60
     gcgggggcgc aggacccggg gagccgcgcc gggaggaggg tcgggcgggt ctcagcccct       120
     cctcgccccc aggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc       180
     gcggggagcc ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg       240
     acagcgacgc cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc       300
     cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga       360
     gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcctg       420
     gggcgcaggt cacgactccc catcccccac gtacggcccg ggtcgccccg agtctccggg       480
     tccgagatcc gcccccctga ggccgcggga cccgcccaaa ccctcgaccg gcgagagccc       540
     caggcgcgtt tacccggttt cattttcagt tgaggccaaa atccccgcgg gttggtcggg       600
     gcggggcggg gctcggggga cggggctgac cgcggggcct gggccagggt ctcacaccct       660
     ccagacgatg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcatgacca       720
     gtccgcctac gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc       780
     cgcggacacg gcggctcaga tcacccagcg caagtgggag gcggcccgtg aggcggagca       840
     gtggagagcc tacctggagg gcctgtgcgt ggagtggctc cgcagatacc tggagaacgg       900
     gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg gagccttccc catctcctat       960
     aggtcgccgg ggatggcctc ccacgagaag aggaggaaaa tgggatcagc gctagaatgt      1020
     cgccctccgt tgaatggaga atggcatgag ttttcctgag tttcctctga gggccccctc      1080
     ttctctctag gacaattaag ggatg                                            1105
//


spacer
spacer