spacer

EBI Dbfetch

ID   EU375850; SV 1; linear; mRNA; STD; HUM; 1122 BP.
XX
AC   EU375850;
XX
DT   29-JAN-2008 (Rel. 94, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) mRNA, HLA-DRB1*120201 variant
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1122
RX   DOI; 10.1111/j.1399-0039.2009.01224.x.
RX   PUBMED; 19493243.
RA   Park M.H., Kim Y., Lee J.Y.;
RT   "Identification of a novel HLA-DRB1 allele, HLA-DRB1*1217, in a Korean
RT   individual";
RL   Tissue Antigens 73(6):627-628(2009).
XX
RN   [2]
RP   1-1122
RA   Park M.-H., Lee J.-Y.;
RT   ;
RL   Submitted (07-JAN-2008) to the INSDC.
RL   Division of Structural and Functional Genomics, Center for Genome Science,
RL   National Institute of Health, Nokbun-dong 5, Seoul 122-701, Korea
XX
DR   MD5; be2e757405f1723b3505595eaf89b001.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1122
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..1122
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT   CDS             1..801
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*120201 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="H-InvDB:HIT000484908.6"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="ABY78039.1"
FT                   /translation="MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLEYSTGECY
FT                   FFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVTELGRPVAESWNSQKDILEDRRAAV
FT                   DTYCRHNYGAVESFTVQRRVEPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSE
FT                   SAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS"
XX
SQ   Sequence 1122 BP; 244 A; 294 C; 325 G; 259 T; 0 other;
     atggtgtgtc tgaagctccc tggaggctcc tgcatgacag cgctgacagt gacactgatg        60
     gtgctgagct ccccactggc tttggctggg gacacccgac cacgtttctt ggagtactct       120
     acgggtgagt gttatttctt caatgggacg gagcgggtgc ggttactgga gagacacttc       180
     cataaccagg aggagctcct gcgcttcgac agcgacgtgg gggagttccg ggcggtgacg       240
     gagctggggc ggcctgtcgc cgagtcctgg aacagccaga aggacatcct ggaagacagg       300
     cgcgccgcgg tggacaccta ttgcagacac aactacgggg ctgtggagag cttcacagtg       360
     cagcggcgag ttgagcctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     cacaacctcc tggtctgctc tgtgagtggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaacg gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gattggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcaccc aagtgtgacg agccctctca cagtggaatg gagagcacgg       660
     tctgaatctg cacagagcaa gatgctgagt ggagtcgggg gctttgtgct gggcctgctc       720
     ttccttgggg ccgggctgtt catctacttc aggaatcaga aaggacactc tggacttcag       780
     ccaacaggat tcctgagctg aaatgcagat gaccacattc aaggaagaac cttctgtccc       840
     agctttgcag aatgaaaagc tttcctgctt ggcagttatt cttccacaag agagggcttt       900
     ctcaggacct ggttgctact ggttcggcaa ctgcagaaaa tgtcctccct tgtggcttcc       960
     tcagctcctg cccttggcct gaagtcccag cattgatgac agcgcctcat cttcaacttt      1020
     tgtgctcccc tttgcctaaa ccgtatggcc tcccgtgcat ctgtactcac cctgtacgac      1080
     aaacacatta cattattaaa tgtttctcaa agatggagtt aa                         1122
//


spacer
spacer