spacer

EBI Dbfetch

ID   EU369696; SV 1; linear; genomic DNA; STD; HUM; 1289 BP.
XX
AC   EU369696;
XX
DT   22-JAN-2008 (Rel. 94, Created)
DT   08-AUG-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*04 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1289
RX   DOI; 10.1111/j.1399-0039.2008.01085.x.
RX   PUBMED; 18721282.
RA   Deng z.H., Yang B.C., Zhou H.Y., Wang D.M., Chen S.W., Xu A.L.;
RT   "Characterization and sequence analysis of the novel HLA-Cw*040105 allele
RT   in a Chinese Uygur individual";
RL   Tissue Antigens 72(2):182-184(2008).
XX
RN   [2]
RP   1-1289
RA   Deng Z.;
RT   ;
RL   Submitted (01-JAN-2008) to the INSDC.
RL   Immunogenetic Laboratory, ShenZhen Blood Center, Mei Gang Nan Street,
RL   NiGang Xi Road, ShenZhen, GuangDong 518035, P.R. China
XX
DR   MD5; cc7a5747da585cec2b4c6886308caac6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1289
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1289
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /note="similar to HLA-Cw*04010101"
FT   mRNA            join(<1..73,204..473,720..>995)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,720..>995)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*04 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B0FZC9"
FT                   /db_xref="IMGT/HLA:C*04:01:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0FZC9"
FT                   /protein_id="ABY74344.1"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 1289 BP; 234 A; 399 C; 456 G; 200 T; 0 other;
     atgcgggtca tggcgccccg aaccctcatc ctgctgctct cgggagccct ggccctgact        60
     gagacctggg ccggtgagtg cggggttggg agggaaacgg cctctgggga gaggagcgag       120
     gggcccgccc ggcgagggcg caggacccgg ggagccgcgc agggaggagg gtcgggcggg       180
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       240
     ctggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagtcc aagaggggag ccgcgggagc cgtgggtgga       360
     gcaggagggg ccggagtatt gggaccggga gacacagaag tacaagcgcc aggcacaggc       420
     tgaccgagtg aacctgcgga aactgcgcgg ctactacaac cagagcgagg acggtgtgtg       480
     accccggccc ggggcgcagg tcacgacccc tccccatccc ccacggacgg cccgggtcgc       540
     cccgagtctc cccgtctgag atccaccccg aggctgcgga acccgcccag accctcgacc       600
     ggagagagcc ccagtcacct ttacccggtt tcattttcag tttaggccaa aatccccgcg       660
     ggttggtcgg gactggggcg gggctcgggg gaccgggctg accacggggg cggggccagg       720
     gtctcacacc ctccagagga tgtttggctg cgacctgggg ccggacgggc gcctcctccg       780
     cgggtataac cagttcgcct acgacggcaa ggattacatc gccctgaacg aggacctgcg       840
     ctcctggact gccgcggaca cggcggctca gatcacccag cgcaagtggg aggcggcccg       900
     tgaggcggag cagcggagag cctacctgga gggcacgtgc gtggagtggc tccgcagata       960
     cctggagaac gggaaggaga cgctgcagcg cgcgggtacc aggggcagtg gggagccttc      1020
     cccatctccc gtagatctcc cgggatggcc tcccacgagg aggggaggaa aatgggatca      1080
     gcgctagaat atcgccctcc cttgaatgga gaatgggatg agttttcctg agtttcctct      1140
     gagggccccc tctgctctct aggacaatta agggatgaag tccttgagga aatggagggg      1200
     aagacagtcc ctggaatact gatcaggggt cccctttgac cactttgacc actgcagcag      1260
     ctgtggtcag gctgctgacc tttctctca                                        1289
//


spacer
spacer