Dbfetch

ID   EU341811; SV 1; linear; genomic DNA; STD; HUM; 810 BP.
XX
AC   EU341811;
XX
DT   12-JAN-2008 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-810
RA   Yang E.K.;
RT   "New B*27 variant found in a Taiwanese volunteer bone marrow donor";
RL   Unpublished.
XX
RN   [2]
RP   1-810
RA   Yang E.K.;
RT   ;
RL   Submitted (13-DEC-2007) to the INSDC.
RL   Laboratory of Immunogenetics, Tzu Chi Stem Cells Centre, Buddhist Tzu Chi
RL   General Hospital, 707 Section 3, Chung Yang Road, Hualien 970, Taiwan
XX
DR   MD5; 498e51e3f690a3504f5f500011cce7de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..810
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>810
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT   mRNA            join(<11..280,525..>800)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT   CDS             join(<11..280,525..>800)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*27:40"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B0FP46"
FT                   /protein_id="ABY58015.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDRESLRNLRGYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /number=2
FT   exon            525..800
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*27 variant"
FT                   /number=3
XX
SQ   Sequence 810 BP; 143 A; 269 C; 297 G; 101 T; 0 other;
     tcgcccccag gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc        60
     ggggagcccc gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac       120
     agcgacgccg cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg       180
     gagtattggg accgggagac acagatctgc aaggccaagg cacagactga ccgagagagc       240
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       420
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       480
     ggcggggctc ggggggacgg ggctgaccgc ggggccgggg ccagggtctc acaccctcca       540
     gaatatgtat ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt accaccagga       600
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgccgc       660
     ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgagg cggagcagct       720
     gagagcctac ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa       780
     ggagacgctg cagcgcgcgg gtaccagggg                                        810
//