Dbfetch

ID   EU325940; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU325940;
XX
DT   01-JAN-2008 (Rel. 94, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*550201novel allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/tan.12073.
RX   PUBMED; 23510423.
RA   Wang L., Shan X., Zhixin Z., Li D., Li W.;
RT   "Identification of a novel HLA-B allele HLA-B*55:34 in a Chinese
RT   individual";
RL   Tissue Antigens 81(4):233-234(2013).
XX
RN   [2]
RP   1-270
RA   Wang D., Shan X., Wang L., Cui S., Wang L., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Wang D., Shan X., Wang L., Cui S., Wang L., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (26-NOV-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 220eda470c317f84c58acbd7fbb0b4aa.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201novel"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201novel"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*55:34"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A9Z0N9"
FT                   /protein_id="ABY21689.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKAQAQTDRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*550201novel"
FT                   /number=2
FT   variation       186
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="results in glutamic acid to asparagine substitution"
FT   variation       188
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="results in glutamic acid to asparagine substitution"
FT   variation       199
FT                   /gene="HLA-B"
FT                   /replace="a"
FT                   /note="results in serine to tyrosine substitution"
XX
SQ   Sequence 270 BP; 56 A; 85 C; 95 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//