spacer

EBI Dbfetch

ID   EU325939; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EU325939;
XX
DT   01-JAN-2008 (Rel. 94, Created)
DT   19-NOV-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*1101novel allele, exon
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/j.1399-0039.2010.01545.x.
RX   PUBMED; 21058939.
RA   Gao S.M., Wang L., Zhang Z.X.;
RT   "A novel allele, HLA-A*11:01:10, identified by sequence-based typing in a
RT   Chinese individual";
RL   Tissue Antigens 76(6):495-495(2010).
XX
RN   [2]
RP   1-276
RA   Wang L., Shan X., Wang L., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z.;
RT   "A novel allele identified by sequence";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Wang L., Shan X., Wang L., Cui S., Wang Z., Ni L., He X., Liu N., Li W.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (16-NOV-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No 37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 1e10a4d7a071a4b75925dce84e798d1c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101novel"
FT   mRNA            <1..>276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101novel"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101novel"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A9Z0N8"
FT                   /db_xref="IMGT/HLA:A*11:01:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A9Z0N8"
FT                   /protein_id="ABY21688.1"
FT                   /translation="SHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
FT                   DMAAQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRT"
FT   exon            1..276
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*1101novel"
FT                   /number=3
FT   variation       167
FT                   /gene="HLA-A"
FT                   /replace="g"
FT                   /note="synonymous substitution"
XX
SQ   Sequence 276 BP; 58 A; 81 C; 100 G; 37 T; 0 other;
     gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg cgcttcctcc        60
     gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcttggac cgcggcggac atggcagctc agatcaccaa gcgcaaatgg gaggcggccc       180
     atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcacgg                                 276
//


spacer
spacer