spacer

EBI Dbfetch

ID   EU292145; SV 1; linear; genomic DNA; STD; ROD; 1175 BP.
XX
AC   EU292145;
XX
DT   26-JUL-2008 (Rel. 96, Created)
DT   26-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Millardia kathleenae voucher PO84 interphotoreceptor retinoid binding
DE   protein (IRBP) gene, partial cds.
XX
KW   .
XX
OS   Millardia kathleenae (Burmese Metad)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Millardia.
XX
RN   [1]
RP   1-1175
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8:199-199(2008).
XX
RN   [2]
RP   1-1175
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   ;
RL   Submitted (16-NOV-2007) to the INSDC.
RL   Lab. Evolution et Diversite Biologique, University Paul Sabatier, 118,
RL   Route de Narbonne, Toulouse Cedex 9 31062, France
XX
DR   MD5; 2cb4300fe18900acb031575bfcd160f5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1175
FT                   /organism="Millardia kathleenae"
FT                   /mol_type="genomic DNA"
FT                   /specimen_voucher="PO84"
FT                   /db_xref="taxon:485426"
FT   gene            <1..>1175
FT                   /gene="IRBP"
FT   mRNA            <1..>1175
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>1175
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4Y118"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4Y118"
FT                   /protein_id="ABX89954.1"
FT                   /translation="MGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDPRLFIS
FT                   YEPGTLEAPQQAPALTNLTREELLAQIQRSIRHEVLEGNVGYLRVDDLPGQEVLSELGE
FT                   FLVSHVWKQLMDTSALVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTTT
FT                   EIWTLPKVLGERYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQ
FT                   KLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRAL
FT                   PGVVHRLQEALQDYYTLVDRVPSLLRHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRL
FT                   LVKATGPRENSSRPDTGPNDPPEATPEVPKEEDARRALVDSVFQVSVLPGNV"
XX
SQ   Sequence 1175 BP; 262 A; 344 C; 339 G; 229 T; 1 other;
     atgggaatgc aagcagccat tgagcaggct atgaagagtc atgagattct ggacatctca        60
     gaccctcaga cactggccca tgtgctgaca gctggagtac agagctccct gaatgaccca       120
     cgtctcttca tctcctatga gcccggcacc ctcgaggctc cccagcaagc accagcgctc       180
     accaacctca cccgagaaga actgctggcc cagatacaga ggagcatccg ccatgaggta       240
     cttgagggca acgtgggcta cctacgggtg gatgacctcc ctggccagga ggtactaagt       300
     gagctggggg aattcttagt gagccatgtg tggaaacagc tcatggacac ctccgccttg       360
     gtgttagatc tccggcactg tgctggtggc catgtttctg gcatccctta tgtcatctcc       420
     tacttgcacc ctgggaacac tgtcatgcay gtggatacca tctacgatcg cccctccaac       480
     accaccacag agatctggac cttgcccaag gtcctaggag agagatacag tgccgacaag       540
     gatgtggtgg tcctcaccag tggacatact gggggagtag ctgaggacat cgcctacatc       600
     ctcaagcaga tgcgcagggc catcgtggtg ggtgagcgga cagagggtgg tgccctggac       660
     ctccagaagc tgagaatagg ccaatccaac ttcttcctca cagtccctgt gtccaggtcc       720
     ctgggacccc taggtggagg tggccagaca tgggaaggca gtggagtgct gccctgtgtg       780
     gggacacctg cagagcaagc cctagaaaag gccctggcca tcctcaccct tcgtcgggcc       840
     ctgcctgggg ttgtccaccg acttcaggaa gccctacagg actattacac attagtggac       900
     cgagtgccga gtctgctgcg ccacctggct agcatggact actcagccgt ggtctctgaa       960
     gaggacctgg tgacgaagct caatgctggc ttacaggctg tgtcagagga tcccaggctc      1020
     ctggtgaaag ccactgggcc cagagaaaac tcctcaagac ctgacactgg gcctaatgac      1080
     cccccagaag ccacccctga ggtgcccaag gaagaagatg cccggagggc cctagtggac      1140
     tctgtgtttc aggtgtccgt gctgccgggc aatgt                                 1175
//


spacer
spacer