spacer

EBI Dbfetch

ID   EU292144; SV 1; linear; genomic DNA; STD; ROD; 1230 BP.
XX
AC   EU292144;
XX
DT   26-JUL-2008 (Rel. 96, Created)
DT   26-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Desmomys harringtoni interphotoreceptor retinoid binding protein (IRBP)
DE   gene, partial cds.
XX
KW   .
XX
OS   Desmomys harringtoni (Harrington's rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Desmomys.
XX
RN   [1]
RP   1-1230
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8:199-199(2008).
XX
RN   [2]
RP   1-1230
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   ;
RL   Submitted (16-NOV-2007) to the INSDC.
RL   Lab. Evolution et Diversite Biologique, University Paul Sabatier, 118,
RL   Route de Narbonne, Toulouse Cedex 9 31062, France
XX
DR   MD5; c2ff32476695ca0ec29a1468d8918fdf.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Desmomys harringtoni"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:121587"
FT   gene            <1..>1230
FT                   /gene="IRBP"
FT   mRNA            <1..>1230
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>1230
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4Y117"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4Y117"
FT                   /protein_id="ABX89953.1"
FT                   /translation="LMGMQAAIEQAMKSHEILDISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEVPQQAPSLTNLTQEELLAQLQKNIHHEVLEGNVGYLRMDDLPGQEVLSELE
FT                   GFLVTHMWGQLMGTSSLVLDLRHFAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVILTSRHTGGVAEDIAYILKQIRRAIVVGEQTQGGALDL
FT                   QKLRIGQSNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGIPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYXTLVDRVPGLLHHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRIIGPRETSSRPETGPNDPPAATPELPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   GFADASVLKTL"
XX
SQ   Sequence 1230 BP; 273 A; 353 C; 344 G; 259 T; 1 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctggacatc        60
     tcagatcctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctct tcatctccta cgagcccagc accctcgagg ttccccagca agcaccatcg       180
     ctcaccaacc tcacccagga agaactgctg gcccagctac agaagaacat ccatcatgag       240
     gttcttgagg gcaacgtagg ctacctacga atggatgacc tccctggtca ggaggtactg       300
     agtgagcttg aggggttctt agtgacccat atgtgggggc agctcatggg cacctcctcc       360
     ttggtgctag atctccggca ctttgctggt ggccatgtct ctggcatccc ttacgtcatc       420
     tcctacttgc accctggaaa cactgtcatg cacgtagata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgatccttac cagtagacat actgggggag tggctgagga catcgcctac       600
     atcctcaagc agatacgcag ggccattgtg gtgggtgagc agacacaggg tggtgccctg       660
     gacctccaga agctcagaat aggtcagtcc aactttttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggatac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag gaagccctac aggactatna cacattagtg       900
     gaccgagtgc caggcctgct gcaccacctg gctagcatgg actactcagc cgtggtctct       960
     gaagaggacc tggtgacaaa gctcaatgct ggcttgcagg ctgtgtcgga ggatcccagg      1020
     ctcctggtga gaatcattgg gcccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagccactcc tgagttgccc aaggaagaag atgcccggag ggccctagtg      1140
     gactctgtgt ttcaagtgtc cgtgctgcca ggcaatgtgg gctacctgcg cttcgacgga      1200
     tttgcagacg cctctgtgct gaagacactg                                       1230
//


spacer
spacer