spacer

EBI Dbfetch

ID   EU292143; SV 1; linear; genomic DNA; STD; ROD; 1230 BP.
XX
AC   EU292143;
XX
DT   26-JUL-2008 (Rel. 96, Created)
DT   26-JUL-2008 (Rel. 96, Last updated, Version 1)
XX
DE   Dasymys incomtus interphotoreceptor retinoid binding protein (IRBP) gene,
DE   partial cds.
XX
KW   .
XX
OS   Dasymys incomtus (African marsh rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Dasymys.
XX
RN   [1]
RP   1-1230
RX   DOI; 10.1186/1471-2148-8-199.
RX   PUBMED; 18616808.
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   "Phylogeny and biogeography of African Murinae based on mitochondrial and
RT   nuclear gene sequences, with a new tribal classification of the subfamily";
RL   BMC Evol. Biol. 8:199-199(2008).
XX
RN   [2]
RP   1-1230
RA   Lecompte E., Aplin K., Denys C., Catzeflis F., Chades M., Chevret P.;
RT   ;
RL   Submitted (16-NOV-2007) to the INSDC.
RL   Lab. Evolution et Diversite Biologique, University Paul Sabatier, 118,
RL   Route de Narbonne, Toulouse Cedex 9 31062, France
XX
DR   MD5; 483cfc0cc753e56801e69269573f289f.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1230
FT                   /organism="Dasymys incomtus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:71173"
FT   gene            <1..>1230
FT                   /gene="IRBP"
FT   mRNA            <1..>1230
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT   CDS             <1..>1230
FT                   /codon_start=1
FT                   /gene="IRBP"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:B4Y116"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B4Y116"
FT                   /protein_id="ABX89952.1"
FT                   /translation="LMGMQAAIEQAMKSHEILGISDPQTLAHVLTAGVQSSLNDPRLFI
FT                   SYEPSTLEAPQQALALTNLTREELLAQIQKNIRHEVLEGNVGYLRVDDLPGQEVLSELE
FT                   EFLVSHVWEQLMGTSSLVLDLRHCAGGHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTT
FT                   TEIWTLPKVLGERYSADKDVVXLTSGHTGGVAEDIAYILKQIRRAIVVGEQTKGGALDL
FT                   QKLRIGESNFFLTVPVSRSLGPLGGGGQTWEGSGVLPCVGTPAEQALEKALAILTLRRA
FT                   LPGVVLRLQEALQDYYTLVDRVPGLLHHLANMDYSAVVSEEDLVTKLNAGLQAVSEDPR
FT                   LLVRVTGPRETSSRPETGPNDPPAATPEVPKEEDARRALVDSVFQVSVLPGNVGYLRFD
FT                   RFADASVLKTL"
XX
SQ   Sequence 1230 BP; 274 A; 350 C; 350 G; 253 T; 3 other;
     ctgatgggaa tgcaagcagc cattgagcag gctatgaaga gtcatgagat tctgggcatc        60
     tcagatcctc agacgctggc ccatgtgctg acagctggag tgcagagttc cttgaatgac       120
     ccacgtctct tcatctccta tgagcccagc accctcgagg ctccccagca agcgctagca       180
     ctcaccaacc tcacccggga agaactgctg gcccagatac agaagaacat ccggcatgag       240
     gttcttgagg gcaatgtagg ctacctacga gtggatgacc tccctggcca ggaggtactg       300
     agtgagcttg aggagttttt agtgagtcat gtgtgggagc agctcatggg cacctcctcc       360
     ttggtgctag acctccggca ctgtgctggt ggccatgtct ctggcatccc ttacgtcatt       420
     tcctacttgc accctggnaa cacngtcatg cacgtagata ccatctatga tcgtccctcc       480
     aacaccacca cagagatctg gaccttgccc aaggtcctag gagagagata cagtgctgac       540
     aaggatgtgg tgntccttac cagtggacat accgggggag tggctgagga cattgcatac       600
     atcctcaagc agatacgcag ggccatcgtg gtgggtgagc agacaaaggg tggtgccctg       660
     gacctccaga agctgagaat aggtgagtcc aacttcttcc tcacagtgcc tgtgtccagg       720
     tccctgggac ccctaggtgg aggtggccag acatgggaag gcagtggagt gctgccctgt       780
     gtggggacac ctgcagagca agccctagaa aaggccctgg ccatcctcac cctgcgtcgt       840
     gccctgccag gggttgtcct ccgacttcag gaagccctcc aggactatta cacattagtg       900
     gaccgagtgc ctggcctgct gcaccacctg gctaacatgg actactcagc cgtggtctct       960
     gaagaggacc tggtaacaaa gctcaatgct ggcttgcagg cagtgtcgga ggatcccagg      1020
     ctcctggtga gagtcactgg gcccagagaa acctcctcaa gacctgagac tgggcctaat      1080
     gaccccccag cagccacccc tgaggtgccc aaggaagaag atgcccgaag ggccctagtg      1140
     gactctgtat ttcaagtgtc cgtgctgcca ggcaatgtgg gctacctacg cttcgacaga      1200
     tttgcagacg cctctgtgct gaagacactg                                       1230
//


spacer
spacer