Dbfetch

ID   EU290674; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EU290674;
XX
DT   21-DEC-2007 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13 allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Yan L., Zhu F.;
RT   "Identification of a novel HLA-DRB1*13 allele by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Yan L., Zhu F.;
RT   ;
RL   Submitted (20-NOV-2007) to the INSDC.
RL   Transfusion Medicine Institution, Blood Center of Zhejiang Province, Wulin
RL   Road, Hangzhou, Zhejiang 310006, China
XX
DR   MD5; 236dcbe0ed3791694cfa973ac43f3525.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A9YTA3"
FT                   /db_xref="IMGT/HLA:DRB1*13:50:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A9YTA3"
FT                   /protein_id="ABX90119.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13"
FT                   /number=2
XX
SQ   Sequence 270 BP; 57 A; 64 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//